KpKP13 Protein target profile

Melibiose carrier protein

Accession: KP13_00464

Gene: melB AHE46802.1 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GM44
Length 471
Pocket druggability (P2Rank · AlphaFold DB model) 0.799
Direct ligand evidence 0 52 total records
Functional annotation 0 EC 5 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
Hit
Human identity (%)
27.389 Lower values reduce human off-target concern.
Human E-value
1.04e-07
Gut microbiome similarity
0.5% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
0.0 Higher values support similarity to known essential genes.

Structure confidence

ColabFold pLDDT
83.64 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.799
Structure A0A0H3GM44
Pocket Pocket 1
Druggability (FPocket) 0.944
Structure A0A0H3GM44
Pocket Pocket 6
ColabFold model
P2Rank 0.954 · Pocket 1
FPocket 0.517 · Pocket 18
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 23 / 4744 genomes with a hit
Prevalence 0.5%

Sequence

Primary amino-acid sequence viewer.

MSISMTTKLSYGFGAFGKDFAIGIVYMYLMYYYTDIVGLSVGVVGTLFLVARILDAIADPIMGWIVNCTRSRWGKFKPWILIGTITNSVVLYMLFSAHHFSGGALLAWVWLTYLLWGFTYTIMDVPFWSLVPTITLDKREREQLVPYPRFFASLAGFVTAGVTLPFVNAVGGADRGFGFQMFTLVLIAFFVVSTLVTLRNVHEVYSSDSGVSEDSSHLSLRQMVALIYKNDQLACLLGMALAYNTAANIIAGFAIYYFTYVIGSAEMFPYYMSYAGAANLLTLILFPRLVKGLSRRILWAGASIMPVLGCGVLLLMALGGVYNIALISLAGVLLNIGTALFWVLQVIMVADTVDYGEYTMNIRCESIAYSVQTLVVKAGSAFAAWFIAIVLGIIGYVPNVVQSSHTLLGMQAIMIALPTLFFALTLFLYFRYYKLNGDMLRRIQIHLLDKYRRVPENDVEPERPIVVPNQV

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

5 GO

Subcellular localization

Localization
CytoplasmicMembrane

Gene Ontology (GO)

5
  • GO:0015293 Enables the active transport of a solute across a membrane by a mechanism whereby two or more species are transported together in the same direction in a tightly coupled process not directly linked to a form of energy other than chemiosmotic energy.
  • GO:0006814 The directed movement of sodium ions (Na+) into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
  • GO:0022857 Enables the transfer of a substance, usually a specific substance or a group of related substances, from one side of a membrane to the other.
  • GO:0008643 The directed movement of carbohydrate into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore. Carbohydrates are a group of organic compounds based of the general formula Cx(H2O)y.
  • GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

49 records
Show feature table
Start End DB Term Name
10 436 Pfam PF13347 MFS/sugar transport protein
59 78 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
32 36 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
8 436 CDD cd17332 MFS_MelB_like
270 290 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
354 373 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
150 171 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
324 346 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
319 323 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
8 428 Gene3D G3DSA:1.20.1250.20 MFS general substrate transporter like domains
8 428 InterPro IPR036259 MFS transporter superfamily
236 258 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
37 58 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
268 290 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
10 438 SUPERFAMILY SSF103473 MFS general substrate transporter
10 438 InterPro IPR036259 MFS transporter superfamily
12 31 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
324 353 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
233 258 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
8 450 NCBIfam TIGR00792 glycoside-pentoside-hexuronide (GPH):cation symporter
8 450 InterPro IPR001927 Sodium:galactoside symporter
131 149 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
36 58 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
108 130 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
150 172 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
172 176 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
199 232 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
9 31 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
259 269 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
411 433 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
297 318 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
433 471 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
291 296 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
1 11 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
59 84 ProSitePatterns PS00872 Sodium:galactoside symporter family signature.
59 84 InterPro IPR018043 Sodium:galactoside symporter, conserved site
297 319 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
177 198 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
3 449 PANTHER PTHR11328 MAJOR FACILITATOR SUPERFAMILY DOMAIN-CONTAINING PROTEIN
3 449 InterPro IPR039672 Lactose permease-like
79 98 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
176 198 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
374 397 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
96 106 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
398 408 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
107 130 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
79 95 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
374 396 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
409 432 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.799
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.449
Likely same site as FPocket 19 1.7 Å 12 shared residues 100% of smaller site
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.096
Show in viewer
Surrounding area
Pocket 4 P2Rank #4
0.091
Show in viewer
Surrounding area
Pocket 5 P2Rank #5
0.047
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #6
0.944
Show in viewer
Surrounding area
Pocket 2 FPocket #16
0.415
Show in viewer
Surrounding area
Pocket 3 FPocket #37
0.409
Show in viewer
Surrounding area
Pocket 4 FPocket #19
0.29
Likely same site as P2Rank 2 1.7 Å 12 shared residues 100% of smaller site
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GM44
AlphaFold DB full sequence Viewing
ColabFold KP13_00464
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

52 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 2 records from similar proteins
Structural ligands 2 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
9PG PDB via homolog 301.3 Da · LogP -1.23 · TPSA 142.5 Open detail RCSB PDB
LMO PDB via homolog Detail RCSB PDB
ZINC1070097 ZINC proposed compound · Tanimoto 1.000 Detail ZINC
ZINC12359987 ZINC proposed compound · Tanimoto 1.000 Detail ZINC
ZINC12359988 ZINC proposed compound · Tanimoto 1.000 Detail ZINC

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
9PG RCSB PDB P30878 301.3 Da LogP -1.23 TPSA 142.5 ✓ Ro5 ✓ Clean c1cc(ccc1[N+](=O)[O-])O[C@@H]2[C@@H]([C@H]([C@H…
LMO RCSB PDB P30878 510.6 Da LogP -0.45 TPSA 178.5 3 viol. ✓ Clean CCCCCCCCCCCCO[C@H]1[C@@H]([C@H]([C@@H]([C@H](O1…

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.