Protein target profile

KP13_32230

Formate dehydrogenase H

Genome: KpKP13 Gene: AHE46828.1 3D evidence: ColabFold model UniProt A0A2U0LLL0
Length 715
Pocket druggability 0.855
Direct ligand evidence 0 61 total records
Functional annotation 0 EC 10 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
11.8% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
0.0 Higher values support similarity to known essential genes.

Localization

Localization
Cytoplasmic

Structure confidence

ColabFold pLDDT
96.71 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

ColabFold / curated model

The selected pocket score is the FPocket value used for ranking after applying the curated structure priority. It estimates small-molecule pocket quality; it is not experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

FPocket 0.855
Structure CB_KP13_32230
Pocket Pocket 1
P2Rank 0.745
Structure CB_KP13_32230
Pocket Pocket 1
ColabFold model
FPocket 0.855 · Pocket 1
P2Rank 0.745 · Pocket 1
Core conservation Accessory gene
Roary accessory
CoreCruncher accessory
Gut microbiome 560 / 4744 genomes with a hit
Prevalence 11.8%

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Sequence

Primary amino-acid sequence viewer.

MKKVVTVCPYCASGCKINLVVDNGKIVRAEAAQGKTNQGTLCLKGYYGWDFINDTQILTPRLKTPMIRRQRGGKLEAVSWDEALDYVATRLSAIKAKYGPDAIQTTGSSRGTGNETNYVMQKFARAVIGTNNVDCCARVUHGPSVAGLHQSVGNGAMSNAITEIDNTDLVFIFGYNPADSHPIVANHVINAKRNGAKIIVCDPRKIETARIADMHIALKNGSNIALLNAIGHVIIEEDLYDKSFVASRSEGFEEYRKIVEGYTPESVEEITGVSAQEIRACARMYASAKSAAILWGMGVTQFYQGVETVRSLTSLAILTGNLGKPNVGVNPVRGQNNVQGACDMGALPDTYPGYQYVKFPENREKFAKAWGVESLPAHTGYRISELPHRAAHGEVRAAYIMGEDPLQTDAELSAVRKAFDDLELVIVQDIFMTKTASAADVILPSTSWGEHEGVYTAADRGFQRFFKAVEPKWDLKTDWQIISEIATRMGYPMHYNNTQEIWDELRHLCPDFYGATYEKMGELGYVMWPCRDESDADQGTSYLFKEKFDTPNGLAQFFTCDWVAPIDKLTDEYPMVLSTVREVGHYSCRSMTGNCAALAALADEPGYAQINTADAERLGIEDEELVWVNSRKGRIITRAQVSDRPNKGAVYMTYQWWIGACNELVSENLSPITKTPEYKYCAVNVERIADQRAAEQYVIDEYNKLKSRLRESAMG

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

10 GO

Gene Ontology (GO)

10
  • GO:0051539 Binding to a 4 iron, 4 sulfur (4Fe-4S) cluster; this cluster consists of four iron atoms, with the inorganic sulfur atoms found between the irons and acting as bridging ligands.
  • GO:0008863 Catalysis of the reaction: formate + NAD+ = CO2 + NADH.
  • GO:0016491 Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
  • GO:0015942 The chemical reactions and pathways involving formate, also known as methanoate, the anion HCOO- derived from methanoic (formic) acid.
  • GO:0043546 Binding to a molybdopterin cofactor (Moco), essential for the catalytic activity of some enzymes, e.g. sulfite oxidase, xanthine dehydrogenase, and aldehyde oxidase. The cofactor consists of a mononuclear molybdenum (Mo-molybdopterin) or tungsten ion (W-molybdopterin) coordinated by one or two molybdopterin ligands.
  • GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
  • GO:1990204 Any protein complex that possesses oxidoreductase activity.
  • GO:0046872 Binding to a metal ion.
  • GO:0003954 Catalysis of the reaction: NADH + H+ + acceptor = NAD+ + reduced acceptor.
  • GO:0022904 A process in which a series of electron carriers operate together to transfer electrons from donors such as NADH and FADH2 to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

36 records
Show feature table
Start End DB Term Name
565 702 SUPERFAMILY SSF50692 ADC-like
565 702 InterPro IPR009010 Aspartate decarboxylase-like domain superfamily
1 56 ProSiteProfiles PS51669 Prokaryotic molybdopterin oxidoreductases 4Fe-4S domain profile.
1 56 InterPro IPR006963 Molybdopterin oxidoreductase, 4Fe-4S domain
2 688 PANTHER PTHR43105 RESPIRATORY NITRATE REDUCTASE
1 53 Pfam PF04879 Molybdopterin oxidoreductase Fe4S4 domain
1 53 InterPro IPR006963 Molybdopterin oxidoreductase, 4Fe-4S domain
140 334 FunFam G3DSA:3.40.228.10:FF:000002 Formate dehydrogenase subunit alpha
6 685 NCBIfam TIGR01591 formate dehydrogenase subunit alpha
6 685 InterPro IPR006478 Formate dehydrogenase, alpha subunit
540 692 PIRSF PIRSF000144 CbbBc
53 444 PIRSF PIRSF000144 CbbBc
615 642 ProSitePatterns PS00932 Prokaryotic molybdopterin oxidoreductases signature 3.
615 642 InterPro IPR006655 Molybdopterin oxidoreductase, prokaryotic, conserved site
140 334 Gene3D G3DSA:3.40.228.10 Dimethylsulfoxide Reductase, domain 2
576 682 Pfam PF01568 Molydopterin dinucleotide binding domain
576 682 InterPro IPR006657 Molybdopterin dinucleotide-binding domain
61 487 Pfam PF00384 Molybdopterin oxidoreductase
61 487 InterPro IPR006656 Molybdopterin oxidoreductase
689 715 Gene3D G3DSA:1.20.5.460 Single helix bin
571 687 CDD cd02790 MopB_CT_Formate-Dh_H
571 687 InterPro IPR041925 Formate dehydrogenase H, molybdopterin-binding domain
433 450 ProSitePatterns PS00490 Prokaryotic molybdopterin oxidoreductases signature 2.
433 450 InterPro IPR006655 Molybdopterin oxidoreductase, prokaryotic, conserved site
73 530 Gene3D G3DSA:3.40.50.740 -
6 23 ProSitePatterns PS00551 Prokaryotic molybdopterin oxidoreductases signature 1.
6 23 InterPro IPR027467 Molybdopterin oxidoreductase, molybdopterin cofactor binding site
572 688 Gene3D G3DSA:2.40.40.20 -
1 54 SMART SM00926 Molybdop_Fe4S4_2
1 54 InterPro IPR006963 Molybdopterin oxidoreductase, 4Fe-4S domain
6 564 CDD cd02753 MopB_Formate-Dh-H
6 564 InterPro IPR041924 Formate dehydrogenase H, N-terminal
572 688 FunFam G3DSA:2.40.40.20:FF:000011 Formate dehydrogenase, alpha subunit
1 55 FunFam G3DSA:2.20.25.90:FF:000001 Formate dehydrogenase subunit alpha
1 563 SUPERFAMILY SSF53706 Formate dehydrogenase/DMSO reductase, domains 1-3
1 55 Gene3D G3DSA:2.20.25.90 -

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · FPocket

Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Site 1 FPocket #1
0.855
Likely same site as P2Rank 2 0.3 Å 26 shared residues 100% of smaller site
Show in viewer
Surrounding area
Site 2 FPocket #4
0.541
Likely same site as P2Rank 4 0.5 Å 12 shared residues 100% of smaller site
Show in viewer
Surrounding area

Binding pockets · P2Rank

Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Site 1 P2Rank #1
0.745
Show in viewer
Surrounding area
Site 2 P2Rank #2
0.709
Likely same site as FPocket 1 0.3 Å 26 shared residues 100% of smaller site
Show in viewer
Surrounding area
Site 3 P2Rank #3
0.482
Show in viewer
Surrounding area
Site 4 P2Rank #4
0.331
Likely same site as FPocket 4 0.5 Å 12 shared residues 100% of smaller site
Show in viewer
Surrounding area
Site 5 P2Rank #5
0.294
Show in viewer
Surrounding area
All structural evidence 0 experimental · 1 predicted

Structural evidence

0 + 1

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
ColabFold KP13_32230
ColabFold full sequence Viewing

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

61 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 11 records from similar proteins
Structural ligands 11 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
2MD PDB via homolog 742.6 Da · LogP -2.53 · TPSA 346.6 Open detail RCSB PDB
4MO PDB via homolog Detail RCSB PDB
6MO PDB via homolog Detail RCSB PDB
FES PDB via homolog Detail RCSB PDB
H2S PDB via homolog Detail RCSB PDB

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
2MD RCSB PDB P07658 742.6 Da LogP -2.53 TPSA 346.6 3 viol. ✓ Clean c1nc2c(n1[C@H]3[C@@H]([C@@H]([C@H](O3)CO[P@@](=…
4MO RCSB PDB P07658 95.9 Da LogP -0.00 TPSA 0.0 ✓ Ro5 ✓ Clean [Mo+4]
6MO RCSB PDB P07658 95.9 Da LogP -0.00 TPSA 0.0 ✓ Ro5 ✓ Clean [Mo+6]
FES RCSB PDB D5AQH0 175.8 Da LogP 1.29 TPSA 0.0 ✓ Ro5 ✓ Clean S1[Fe]S[Fe]1
H2S RCSB PDB D5AQH0 34.1 Da LogP 0.11 TPSA 0.0 ✓ Ro5 ✓ Clean S
LCP RCSB PDB P81186 99.4 Da LogP -4.76 TPSA 92.2 ✓ Ro5 ✓ Clean [O-]Cl(=O)(=O)=O
MGD RCSB PDB P07658 740.6 Da LogP -2.06 TPSA 346.6 3 viol. ✓ Clean c1nc2c(n1[C@H]3[C@@H]([C@@H]([C@H](O3)CO[P@@](=…
MO RCSB PDB P81186 95.9 Da LogP -0.00 TPSA 0.0 ✓ Ro5 ✓ Clean [Mo]
MOS RCSB PDB P39185 161.0 Da LogP 0.14 TPSA 34.1 ✓ Ro5 ✓ Clean O=[Mo](=O)S
NO2 RCSB PDB P07658 46.0 Da LogP 0.25 TPSA 52.5 ✓ Ro5 ✓ Clean N(=O)[O-]
W RCSB PDB Q934F5 183.8 Da LogP -0.00 TPSA 0.0 ✓ Ro5 ✓ Clean [W+6]

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.