KpKP13 Protein target profile

TPR-like domain-containing protein

Accession: KP13_00436

Gene: AHE46829.1 3D evidence: Experimental + ColabFold model UniProt A6TH02
Export view
Length 228
Pocket druggability (P2Rank · Experimental) 0.046
Functional annotation 0 EC 1 GO
Target summary

Target candidate with partial support; inspect missing evidence before prioritizing.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Main supporting evidence

Experimental structure available At least one PDB experimental structure is loaded, not just a predicted model - stronger structural coverage than AlphaFold/ColabFold alone. No similar human protein detected The current BLAST sequence screen did not find a significant human match, lowering apparent off-target risk. Core gene across strains Marked as conserved by both pan-genome tools: Roary and CoreCruncher. Structure available Experimental + ColabFold model

Risks to review

Microbiome similarity 49 of 4744 screened genomes (1.0%) have a significant similarity hit. Weak predicted binding pocket FPocket selected-pocket score 0.34. Weak second pocket-predictor signal P2Rank predicted binding-site probability 0.05.

Evidence gaps

No metabolic context No SBML/network-derived reaction evidence is loaded for this protein. No ligand evidence No experimental PDB ligands, measured ChEMBL bioactivity, or proposed ZINC compound records are available.
Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
1.0% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
0.0 Higher values support similarity to known essential genes.

Structure confidence

ColabFold pLDDT
93.83 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

PDB experimental structure

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.046
Structure 3RJV
Pocket Pocket 1
Druggability (FPocket) 0.343
Structure 3RJV
Pocket Pocket 1
ColabFold model
P2Rank 0.172 · Pocket 1
FPocket 0.299 · Pocket 1
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 49 / 4744 genomes with a hit
Prevalence 1.0%

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Sequence

UniProt A6TH02

Structure

PDB 3RJV

Sequence

Primary amino-acid sequence viewer.

MKYLFLFLLVFTSGAAVATEPGSQYQQQAEAGDRRAQYYLADTWVSSGDYQKAEYWAQKAAAQGDGDALALLAQLKIRNPQQADYPQARQLAEKAVEAGSKSGEIVLARVLVNRQAGATDVAHAITLLQDAARDSESDAAVDAQMLLGLIYASGVHGPEDDVKASEYFKGSSSLSRTGYAEYWAGMMFQQGEKGFIEPNKQKALHWLNVSCLEGFDTGCEEFDRISKG

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 GO

Subcellular localization

Localization
Unknown

Gene Ontology (GO)

1

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

29 records
Show feature table
Start End DB Term Name
24 100 SUPERFAMILY SSF81901 HCP-like
1 18 SignalP_GRAM_NEGATIVE SignalP-noTM SignalP-noTM
4 12 Phobius SIGNAL_PEPTIDE_H_REGION Hydrophobic region of a signal peptide.
83 100 Pfam PF08238 Sel1 repeat
83 100 InterPro IPR006597 Sel1-like repeat
142 169 Pfam PF08238 Sel1 repeat
142 169 InterPro IPR006597 Sel1-like repeat
36 65 Pfam PF08238 Sel1 repeat
36 65 InterPro IPR006597 Sel1-like repeat
179 208 Pfam PF08238 Sel1 repeat
179 208 InterPro IPR006597 Sel1-like repeat
25 140 PANTHER PTHR11102 SEL-1-LIKE PROTEIN
164 228 Gene3D G3DSA:1.25.40.740 -
66 100 SMART SM00671 sel1
66 100 InterPro IPR006597 Sel1-like repeat
141 176 SMART SM00671 sel1
141 176 InterPro IPR006597 Sel1-like repeat
34 65 SMART SM00671 sel1
34 65 InterPro IPR006597 Sel1-like repeat
178 215 SMART SM00671 sel1
178 215 InterPro IPR006597 Sel1-like repeat
1 3 Phobius SIGNAL_PEPTIDE_N_REGION N-terminal region of a signal peptide.
1 18 Phobius SIGNAL_PEPTIDE Signal peptide region
1 18 SignalP_GRAM_POSITIVE SignalP-TM SignalP-TM
19 228 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
18 163 Gene3D G3DSA:1.25.40.10 Tetratricopeptide repeat domain
18 163 InterPro IPR011990 Tetratricopeptide-like helical domain superfamily
13 18 Phobius SIGNAL_PEPTIDE_C_REGION C-terminal region of a signal peptide.
82 213 SUPERFAMILY SSF81901 HCP-like

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.046
Likely same site as FPocket 1 7.6 Å 3 shared residues 43% of smaller site
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.017
Likely same site as FPocket 1 1.9 Å 9 shared residues 100% of smaller site
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #1
0.343
Likely same site as P2Rank 2 1.9 Å 9 shared residues 100% of smaller site
Show in viewer
Surrounding area
All structural evidence 1 experimental · 1 predicted

Structural evidence

1 + 1

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
PDB 3RJV
X-ray — A —
PDBe RCSB PDBj File
Viewing
ColabFold KP13_00436
ColabFold — — full sequence — Loaded