Target candidate with partial support; inspect missing evidence before prioritizing.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- Hit
- Human identity (%)
- 38.889 Lower values reduce human off-target concern.
- Human E-value
- 3.24e-16
- Gut microbiome similarity
- 3.3% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- Y
- DEG identity (%)
- 93.82 Higher values support similarity to known essential genes.
- DEG E-value
- 1.23e-118 Smaller values mean stronger essential-gene similarity.
Localization
- Localization
- Cytoplasmic
Structure confidence
- ColabFold pLDDT
- 80.29 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
PDB experimental structureThe selected pocket score is the FPocket value used for ranking after applying the curated structure priority. It estimates small-molecule pocket quality; it is not experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.
Sequence
Sequence
Primary amino-acid sequence viewer.
MASRGVNKVILVGNLGQDPEVRYMPSGGAVANFTLATSESWRDKQTGEMKEQTEWHRVVLFGKLAEVAGEYLRKGSQVYIEGQLRTRKWTDQSGQDKYTTEVVVNVGGTMQMLGGRQGGGAPAGGGQQQGGWGQPQQPQGGNQFSGGAQSRPQQQAPAAPSNEPPMDFDDDIPF
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Gene Ontology (GO)
2- GO:0006260 The cellular metabolic process in which a cell duplicates one or more molecules of DNA. DNA replication begins when specific sequences, known as origins of replication, are recognized and bound by the origin recognition complex, and ends when the original DNA molecule has been completely duplicated and the copies topologically separated. The unit of replication usually corresponds to the genome of the cell, an organelle, or a virus. The template for replication can either be an existing DNA molecule or RNA.
- GO:0003697 Binding to single-stranded DNA.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 3 | 149 | PANTHER | PTHR10302 | SINGLE-STRANDED DNA-BINDING PROTEIN |
| 3 | 149 | InterPro | IPR011344 | Single-stranded DNA-binding protein |
| 6 | 112 | Pfam | PF00436 | Single-strand binding protein family |
| 6 | 112 | InterPro | IPR000424 | Primosome PriB/single-strand DNA-binding |
| 6 | 111 | ProSiteProfiles | PS50935 | Single-strand binding (SSB) domain profile. |
| 6 | 111 | InterPro | IPR000424 | Primosome PriB/single-strand DNA-binding |
| 2 | 142 | FunFam | G3DSA:2.40.50.140:FF:000065 | Single-stranded DNA-binding protein |
| 9 | 105 | CDD | cd04496 | SSB_OBF |
| 9 | 105 | InterPro | IPR000424 | Primosome PriB/single-strand DNA-binding |
| 2 | 157 | PIRSF | PIRSF002070 | SSB |
| 2 | 157 | InterPro | IPR011344 | Single-stranded DNA-binding protein |
| 4 | 174 | NCBIfam | TIGR00621 | single-stranded DNA-binding protein |
| 4 | 174 | InterPro | IPR011344 | Single-stranded DNA-binding protein |
| 6 | 117 | Hamap | MF_00984 | Single-stranded DNA-binding protein. |
| 6 | 117 | InterPro | IPR011344 | Single-stranded DNA-binding protein |
| 129 | 157 | MobiDBLite | mobidb-lite | consensus disorder prediction |
| 109 | 174 | MobiDBLite | mobidb-lite | consensus disorder prediction |
| 4 | 174 | SUPERFAMILY | SSF50249 | Nucleic acid-binding proteins |
| 4 | 174 | InterPro | IPR012340 | Nucleic acid-binding, OB-fold |
| 2 | 143 | Gene3D | G3DSA:2.40.50.140 | - |
| 2 | 143 | InterPro | IPR012340 | Nucleic acid-binding, OB-fold |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
No pockets are loaded yet for the displayed PDB 7F2N structure. Run experimental pocket backfill to show FPocket/P2Rank overlays on this structure.
How colors and pocket overlays are used
All structural evidence
Structural evidence
2 + 1Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural ligand evidence is available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC3874317 ZINC | 1.000 | 318.2 Da LogP 1.69 TPSA 151.6 | 1 viol. | Alert |
O=c1c(O)c(-c2cc(O)c(O)c(O)c2)oc2cc(O)cc(O)c12
|
| ZINC6483599 ZINC | 0.769 | 332.3 Da LogP 2.00 TPSA 140.6 | ✓ Ro5 | Alert |
COc1cc(-c2oc3cc(O)cc(O)c3c(=O)c2O)cc(O)c1O
|
| ZINC3869685 ZINC | 0.757 | 302.2 Da LogP 1.99 TPSA 131.4 | ✓ Ro5 | Alert |
O=c1c(O)c(-c2ccc(O)c(O)c2)oc2cc(O)cc(O)c12
|
| ZINC3869768 ZINC | 0.750 | 286.2 Da LogP 2.28 TPSA 111.1 | ✓ Ro5 | ✓ Clean |
O=c1c(O)c(-c2ccc(O)cc2)oc2cc(O)cc(O)c12
|
| ZINC13838618 ZINC | 0.744 | 332.3 Da LogP 2.00 TPSA 140.6 | ✓ Ro5 | ✓ Clean |
COc1c(O)cc(-c2oc3cc(O)cc(O)c3c(=O)c2O)cc1O
|
| ZINC120273 ZINC | 0.730 | 270.2 Da LogP 2.58 TPSA 90.9 | ✓ Ro5 | ✓ Clean |
O=c1c(O)c(-c2ccccc2)oc2cc(O)cc(O)c12
|
| ZINC6483609 ZINC | 0.700 | 346.3 Da LogP 2.30 TPSA 129.6 | ✓ Ro5 | ✓ Clean |
COc1cc(-c2oc3cc(O)cc(O)c3c(=O)c2O)cc(OC)c1O
|
| ZINC13860547 ZINC | 0.682 | 370.4 Da LogP 3.50 TPSA 131.4 | ✓ Ro5 | Alert |
CC(C)=CCc1cc(-c2oc3cc(O)cc(O)c3c(=O)c2O)cc(O)c1O
|
| ZINC3881558 ZINC | 0.676 | 302.2 Da LogP 1.99 TPSA 131.4 | ✓ Ro5 | ✓ Clean |
O=c1c(O)c(-c2ccc(O)cc2O)oc2cc(O)cc(O)c12
|
| ZINC6483700 ZINC | 0.667 | 360.3 Da LogP 2.60 TPSA 118.6 | ✓ Ro5 | ✓ Clean |
COc1cc(-c2oc3cc(O)cc(O)c3c(=O)c2O)cc(OC)c1OC
|
| ZINC14644239 ZINC | 0.658 | 302.2 Da LogP 1.99 TPSA 131.4 | ✓ Ro5 | ✓ Clean |
O=c1c(O)c(-c2c(O)cccc2O)oc2cc(O)cc(O)c12
|
| ZINC6095498 ZINC | 0.658 | 286.2 Da LogP 2.28 TPSA 111.1 | ✓ Ro5 | ✓ Clean |
O=c1c(O)c(-c2ccccc2O)oc2cc(O)cc(O)c12
|
| ZINC6484604 ZINC | 0.651 | 316.3 Da LogP 2.29 TPSA 120.4 | ✓ Ro5 | ✓ Clean |
COc1ccc(-c2oc3cc(O)cc(O)c3c(=O)c2O)cc1O
|
| ZINC584641356 ZINC | 0.643 | 338.2 Da LogP 3.60 TPSA 90.9 | ✓ Ro5 | ✓ Clean |
O=c1c(O)c(-c2ccc(C(F)(F)F)cc2)oc2cc(O)cc(O)c12
|
| ZINC6411540 ZINC | 0.643 | 300.3 Da LogP 2.59 TPSA 100.1 | ✓ Ro5 | ✓ Clean |
COc1ccc(-c2oc3cc(O)cc(O)c3c(=O)c2O)cc1
|
| ZINC14436449 ZINC | 0.641 | 318.2 Da LogP 1.69 TPSA 151.6 | 1 viol. | Alert |
O=c1c(O)c(-c2ccc(O)c(O)c2O)oc2cc(O)cc(O)c12
|
| ZINC4098600 ZINC | 0.615 | 302.2 Da LogP 1.99 TPSA 131.4 | ✓ Ro5 | Alert |
O=c1c(O)c(-c2cc(O)c(O)c(O)c2)oc2cc(O)ccc12
|
| ZINC517261 ZINC | 0.614 | 316.3 Da LogP 2.29 TPSA 120.4 | ✓ Ro5 | ✓ Clean |
COc1cc(-c2oc3cc(O)cc(O)c3c(=O)c2O)ccc1O
|
| ZINC6018683 ZINC | 0.614 | 330.3 Da LogP 2.59 TPSA 109.4 | ✓ Ro5 | ✓ Clean |
COc1ccc(-c2oc3cc(O)cc(O)c3c(=O)c2O)cc1OC
|
| ZINC1775964630 ZINC | 0.595 | 349.1 Da LogP 3.34 TPSA 90.9 | ✓ Ro5 | ✓ Clean |
O=c1c(O)c(-c2ccccc2Br)oc2cc(O)cc(O)c12
|
| ZINC13520048 ZINC | 0.590 | 302.2 Da LogP 1.99 TPSA 131.4 | ✓ Ro5 | Alert |
O=c1cc(-c2cc(O)c(O)c(O)c2)oc2cc(O)cc(O)c12
|
| ZINC39204543 ZINC | 0.588 | 480.4 Da LogP -0.83 TPSA 230.7 | 2 viol. | Alert |
O=c1c(O)c(-c2cc(O)c(O)c(O[C@@H]3O[C@H](CO)[C@@H…
|
| ZINC79316265 ZINC | 0.581 | 382.3 Da LogP 1.23 TPSA 185.7 | 1 viol. | Alert |
O=c1c(O)c(-c2cc(O)c(O)cc2S(=O)(=O)O)oc2cc(O)cc(…
|
| ZINC105019195 ZINC | 0.580 | 464.4 Da LogP 0.19 TPSA 210.5 | 2 viol. | Alert |
C[C@@H]1O[C@H](Oc2c(-c3cc(O)c(O)c(O)c3)oc3cc(O)…
|
| ZINC12153442 ZINC | 0.580 | 464.4 Da LogP 0.19 TPSA 210.5 | 2 viol. | Alert |
C[C@H]1O[C@H](Oc2c(-c3cc(O)c(O)c(O)c3)oc3cc(O)c…
|
| ZINC140669683 ZINC | 0.580 | 464.4 Da LogP 0.19 TPSA 210.5 | 2 viol. | Alert |
C[C@@H]1O[C@H](Oc2c(-c3cc(O)c(O)c(O)c3)oc3cc(O)…
|
| ZINC35092275 ZINC | 0.580 | 464.4 Da LogP 0.19 TPSA 210.5 | 2 viol. | Alert |
C[C@@H]1O[C@H](Oc2c(-c3cc(O)c(O)c(O)c3)oc3cc(O)…
|
| ZINC4098556 ZINC | 0.580 | 464.4 Da LogP 0.19 TPSA 210.5 | 2 viol. | Alert |
C[C@@H]1O[C@@H](Oc2c(-c3cc(O)c(O)c(O)c3)oc3cc(O…
|
| ZINC43465458 ZINC | 0.580 | 464.4 Da LogP 0.19 TPSA 210.5 | 2 viol. | Alert |
C[C@@H]1O[C@H](Oc2c(-c3cc(O)c(O)c(O)c3)oc3cc(O)…
|
| ZINC4349559 ZINC | 0.580 | 462.4 Da LogP 0.40 TPSA 201.3 | 2 viol. | Alert |
C[C@H]1O[C@@H](Cc2c(-c3cc(O)c(O)c(O)c3)oc3cc(O)…
|
| ZINC4349562 ZINC | 0.580 | 462.4 Da LogP 0.40 TPSA 201.3 | 2 viol. | Alert |
C[C@H]1O[C@H](Cc2c(-c3cc(O)c(O)c(O)c3)oc3cc(O)c…
|
| ZINC4692013 ZINC | 0.580 | 464.4 Da LogP 0.19 TPSA 210.5 | 2 viol. | Alert |
C[C@H]1O[C@@H](Oc2c(-c3cc(O)c(O)c(O)c3)oc3cc(O)…
|
| ZINC4692014 ZINC | 0.580 | 464.4 Da LogP 0.19 TPSA 210.5 | 2 viol. | Alert |
C[C@@H]1O[C@@H](Oc2c(-c3cc(O)c(O)c(O)c3)oc3cc(O…
|
| ZINC4692015 ZINC | 0.580 | 464.4 Da LogP 0.19 TPSA 210.5 | 2 viol. | Alert |
C[C@H]1O[C@@H](Oc2c(-c3cc(O)c(O)c(O)c3)oc3cc(O)…
|
| ZINC4692016 ZINC | 0.580 | 464.4 Da LogP 0.19 TPSA 210.5 | 2 viol. | Alert |
C[C@@H]1O[C@@H](Oc2c(-c3cc(O)c(O)c(O)c3)oc3cc(O…
|
| ZINC6536273 ZINC | 0.575 | 302.2 Da LogP 1.99 TPSA 131.4 | ✓ Ro5 | Alert |
O=c1c(O)c(-c2ccc(O)cc2)oc2cc(O)c(O)c(O)c12
|
| ZINC4349582 ZINC | 0.571 | 300.3 Da LogP 2.59 TPSA 111.1 | ✓ Ro5 | Alert |
Cc1c(-c2ccc(O)c(O)c2)oc2cc(O)cc(O)c2c1=O
|
| ZINC168135334 ZINC | 0.568 | 344.3 Da LogP 2.90 TPSA 109.4 | ✓ Ro5 | ✓ Clean |
COc1cc(-c2oc3cc(O)cc(O)c3c(=O)c2C)cc(OC)c1O
|
| ZINC5784821 ZINC | 0.561 | 318.2 Da LogP 1.69 TPSA 151.6 | 1 viol. | Alert |
O=c1c(O)c(-c2ccc(O)c(O)c2)oc2cc(O)c(O)c(O)c12
|
| ZINC59765976 ZINC | 0.560 | 450.4 Da LogP -0.19 TPSA 210.5 | 2 viol. | Alert |
O=c1c(O[C@@H]2OC[C@H](O)[C@H](O)[C@H]2O)c(-c2cc…
|
| ZINC3875620 ZINC | 0.556 | 316.3 Da LogP 2.29 TPSA 120.4 | ✓ Ro5 | Alert |
COc1cc(O)c2c(=O)c(O)c(-c3ccc(O)c(O)c3)oc2c1
|
| ZINC13130924 ZINC | 0.551 | 354.4 Da LogP 3.79 TPSA 111.1 | ✓ Ro5 | ✓ Clean |
CC(C)=CCc1cc(-c2oc3cc(O)cc(O)c3c(=O)c2O)ccc1O
|
| ZINC14761282 ZINC | 0.550 | 274.2 Da LogP 2.08 TPSA 111.1 | ✓ Ro5 | Alert |
Cc1c(O)c(O)cc2oc3cc(O)cc(O)c3c(=O)c12
|
| ZINC38981175 ZINC | 0.550 | 286.2 Da LogP 2.28 TPSA 111.1 | ✓ Ro5 | Alert |
O=c1c(O)c(-c2cc(O)c(O)c(O)c2)oc2ccccc12
|
| ZINC5733531 ZINC | 0.545 | 314.3 Da LogP 2.89 TPSA 89.1 | ✓ Ro5 | ✓ Clean |
COc1ccc(-c2oc3cc(OC)cc(O)c3c(=O)c2O)cc1
|
| ZINC5998754 ZINC | 0.545 | 300.3 Da LogP 2.59 TPSA 100.1 | ✓ Ro5 | ✓ Clean |
COc1cc(O)c2c(=O)c(O)c(-c3ccc(O)cc3)oc2c1
|
| ZINC5998785 ZINC | 0.543 | 316.3 Da LogP 2.29 TPSA 120.4 | ✓ Ro5 | Alert |
COc1cc(O)cc2oc(-c3ccc(O)c(O)c3)c(O)c(=O)c12
|
| ZINC6093875 ZINC | 0.538 | 260.2 Da LogP 1.77 TPSA 111.1 | ✓ Ro5 | Alert |
O=c1c2c(O)cc(O)cc2oc2ccc(O)c(O)c12
|
| ZINC14436790 ZINC | 0.533 | 374.3 Da LogP 2.91 TPSA 107.6 | ✓ Ro5 | ✓ Clean |
COc1cc(-c2oc3cc(O)cc(O)c3c(=O)c2OC)cc(OC)c1OC
|
| ZINC5732368 ZINC | 0.533 | 284.3 Da LogP 2.88 TPSA 79.9 | ✓ Ro5 | ✓ Clean |
COc1cc(O)c2c(=O)c(O)c(-c3ccccc3)oc2c1
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.