KpKP13 Protein target profile

Class B acid phosphatase

Accession: KP13_00392

Gene: aphA AHE46870.1 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GLY0
Length 237
Pocket druggability (P2Rank · AlphaFold DB model) 0.882
Direct ligand evidence 0 53 total records
Functional annotation 0 EC 2 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
1.9% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
81.857 Higher values support similarity to known essential genes.
DEG E-value
3.1899999999999997e-147 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
92.94 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.882
Structure A0A0H3GLY0
Pocket Pocket 1
Druggability (FPocket) 0.338
Structure A0A0H3GLY0
Pocket Pocket 12
ColabFold model
P2Rank 0.816 · Pocket 1
FPocket 0.198 · Pocket 1
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 89 / 4744 genomes with a hit
Prevalence 1.9%

Sequence

Primary amino-acid sequence viewer.

MRKLTLALAAASLLFTLNSAVVARASTPQPLWVGTNVAQLAEQAPIHWVSVAQIENSLLGRPPMAVGFDIDDTVLFSSPGFWRGQKTFSPGSEDYLKNPQFWEKMNNGWDEFSMPKEVARQLIAMHVKRGDSIWFVTGRSQTKTETVSKTLQDDFLIPAANMNPVIFAGDKPGQNTKTQWLQAKQIKVFYGDSDNDITAAREAGARGIRVLRAANSSYKPLPMAGALGEEVIVNSEY

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

2 GO

Subcellular localization

Localization
Unknown

Gene Ontology (GO)

2
  • GO:0003993 Catalysis of the reaction: an orthophosphoric monoester + H2O = an alcohol + phosphate, with an acid pH optimum.
  • GO:0030288 The region between the inner (cytoplasmic or plasma) membrane and outer membrane of organisms with two membranes such as Gram negative bacteria. These periplasmic spaces are relatively thick and contain a thin peptidoglycan layer (PGL), also referred to as a thin cell wall.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

20 records
Show feature table
Start End DB Term Name
1 237 SFLD SFLDS00003 Haloacid Dehalogenase
32 237 SUPERFAMILY SSF56784 HAD-like
32 237 InterPro IPR036412 HAD-like superfamily
1 25 Phobius SIGNAL_PEPTIDE Signal peptide region
1 25 SignalP_GRAM_POSITIVE SignalP-TM SignalP-TM
1 25 SignalP_GRAM_NEGATIVE SignalP-noTM SignalP-noTM
1 237 NCBIfam TIGR01672 acid phosphatase AphA
1 237 InterPro IPR010025 HAD-superfamily phosphatase, subfamily IIIB, AphA
1 237 PIRSF PIRSF017818 Acid_Ptase_B
18 25 Phobius SIGNAL_PEPTIDE_C_REGION C-terminal region of a signal peptide.
1 3 Phobius SIGNAL_PEPTIDE_N_REGION N-terminal region of a signal peptide.
1 237 SFLD SFLDG01127 C1.3: Acid Phosphatase Like
26 237 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
24 237 Gene3D G3DSA:3.40.50.1000 -
24 237 InterPro IPR023214 HAD superfamily
51 237 CDD cd07499 HAD_CBAP
51 237 InterPro IPR010025 HAD-superfamily phosphatase, subfamily IIIB, AphA
11 220 Pfam PF03767 HAD superfamily, subfamily IIIB (Acid phosphatase)
11 220 InterPro IPR005519 Acid phosphatase, class B-like
4 17 Phobius SIGNAL_PEPTIDE_H_REGION Hydrophobic region of a signal peptide.

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.882
Likely same site as FPocket 12 1.9 Å 21 shared residues 100% of smaller site
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #12
0.338 Unusual size
Likely same site as P2Rank 1 1.9 Å 21 shared residues 100% of smaller site
Show in viewer
Surrounding area
Residue sets
UniProt: Active site:69-69 Nucleophile
UniProt: Active site:71-71 Proton donor
UniProt: Binding site:137-138
UniProt: Binding site:177-177
UniProt: Binding site:192-192
UniProt: Binding site:69-69
UniProt: Binding site:71-71
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GLY0
AlphaFold DB full sequence Viewing
ColabFold KP13_00392
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

53 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 3 records from similar proteins
Structural ligands 3 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
ADN PDB via homolog 267.2 Da · LogP -1.98 · TPSA 139.5 Open detail RCSB PDB
AF3 PDB via homolog Detail RCSB PDB
SPM PDB via homolog Detail RCSB PDB
ZINC1532734 ZINC proposed compound · Tanimoto 1.000 Detail ZINC
ZINC2047403 ZINC proposed compound · Tanimoto 1.000 Detail ZINC

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
ADN RCSB PDB P0AE22 267.2 Da LogP -1.98 TPSA 139.5 ✓ Ro5 ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
AF3 RCSB PDB P0AE22 84.0 Da LogP 0.88 TPSA 0.0 ✓ Ro5 ✓ Clean F[Al](F)F
SPM RCSB PDB P0AE22 202.3 Da LogP -0.36 TPSA 76.1 ✓ Ro5 ✓ Clean C(CCNCCCN)CNCCCN

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.