KpKP13 Protein target profile

Maltose transport system permease protein malF

Accession: KP13_00371

Gene: AHE46890.1 malF 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GGU7
Export view
Length 514
Pocket druggability (P2Rank · AlphaFold DB model) 0.734
Functional annotation 0 EC 5 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Main supporting evidence

No similar human protein detected The current BLAST sequence screen did not find a significant human match, lowering apparent off-target risk. Core gene across strains Marked as conserved by both pan-genome tools: Roary and CoreCruncher. Moderate predicted binding pocket FPocket selected-pocket score 0.51. This supports review but is not experimental validation. Second pocket predictor agrees P2Rank predicted binding-site probability 0.73. Review the complete evidence below

Risks to review

Microbiome similarity 106 of 4744 screened genomes (2.2%) have a significant similarity hit. This target also has a predicted binding pocket (P2Rank 0.73) — check the ligand evidence before deprioritizing on off-target risk alone.

Evidence gaps

No metabolic context No SBML/network-derived reaction evidence is loaded for this protein. No ligand evidence No experimental PDB ligands, measured ChEMBL bioactivity, or proposed ZINC compound records are available.
Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
2.2% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
0.0 Higher values support similarity to known essential genes.

Structure confidence

ColabFold pLDDT
90.37 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.734
Structure A0A0H3GGU7
Pocket Pocket 1
Druggability (FPocket) 0.51
Structure A0A0H3GGU7
Pocket Pocket 25
ColabFold model
P2Rank 0.591 · Pocket 1
FPocket 0.4 · Pocket 2
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 106 / 4744 genomes with a hit
Prevalence 2.2%

Sequence

Primary amino-acid sequence viewer.

MDAVKKRHWWQSPQLTWSVIGLLCLLVGYLVVLMYAQGEYLFAIMTLILSSVGLYIFANRKAYAWRYVYPGLAGMGLFVLFPLICTIAIAFTNYSSTNQLTFERAQQVLMDRSFQAGKAYNFTLIPAGDEWKLALTDGESGKNYLSDAFKFGGEQKLALKETDALPEGERANLRVITQNRTALNQLTAVLPDDSKVIMSSLRQFSGTQPLYTLGEDGVLTNNQTHVKYRPNNDVGFYQSINADGSWGNEKLSPGYTVTIGWDNFTRVFHDEGIQKPFFAIFVWTVVFSVLTVVLTVAVGMILACLVQWEALKGKAIYRVLLILPYAVPSFISILIFKGLFNQSFGEINMMLSTLFGIKPAWFSDPTTARTMIIIVNTWLGYPYMMILCMGLLKAIPDDLYEASAMDGAGPFQNFFKITFPLLIKPLTPLMIASFAFNFNNFVLIQLLTNGGPDRLGTTTPAGYTDLLVSYTYRIAFEGGGGQDFGLAAAIATLIFLLVGALAIVNLKATRMKFD

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

5 GO

Subcellular localization

Localization
CytoplasmicMembrane

Gene Ontology (GO)

5
  • GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
  • GO:0055085 The process in which a solute is transported across a lipid bilayer, from one side of a membrane to the other.
  • GO:1990060 Protein complex facilitating ATP-dependent maltose transport through inner cell membrane (periplasm to cytoplasm) in Gram-negative bacteria. In E. coli the system is composed of a periplasmic maltose-binding protein (MBP), two integral membrane proteins, MalF and MalG, and two copies of the cytoplasmic ATP-binding cassette MalK.
  • GO:0015423 Enables the transfer of a solute or solutes from one side of a membrane to the other according to the reaction: ATP + H2O + maltose(out) = ADP + phosphate + maltose(in).
  • GO:0042956 The directed movement of maltodextrin, any polysaccharide of glucose residues in beta-(1,4) linkage, across a membrane.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

47 records
Show feature table
Start End DB Term Name
484 506 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
319 341 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
15 34 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
92 276 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
13 35 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
15 260 SUPERFAMILY SSF160964 MalF N-terminal region-like
1 14 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
277 303 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
341 370 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
281 505 ProSiteProfiles PS50928 ABC transporter integral membrane type-1 domain profile.
281 505 InterPro IPR000515 ABC transporter type 1, transmembrane domain MetI-like
100 260 Pfam PF14785 Maltose transport system permease protein MalF P2 domain
100 260 InterPro IPR029345 Maltose transport system permease protein MalF, P2 domain
315 340 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
304 314 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
297 501 Pfam PF00528 Binding-protein-dependent transport system inner membrane component
297 501 InterPro IPR000515 ABC transporter type 1, transmembrane domain MetI-like
413 435 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
371 392 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
284 306 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
4 513 PANTHER PTHR47314 MALTOSE/MALTODEXTRIN TRANSPORT SYSTEM PERMEASE PROTEIN MALF
370 392 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
118 205 FunFam G3DSA:2.40.430.10:FF:000001 Maltose ABC transporter permease MalF
413 436 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
270 514 Gene3D G3DSA:1.10.3720.10 -
270 514 InterPro IPR035906 MetI-like superfamily
393 412 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
67 91 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
118 205 Gene3D G3DSA:2.40.430.10 -
118 205 InterPro IPR047103 Maltose transport system permease protein MalF, P2 domain superfamily
299 498 CDD cd06261 TM_PBP2
299 498 InterPro IPR000515 ABC transporter type 1, transmembrane domain MetI-like
59 66 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
70 92 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
270 514 FunFam G3DSA:1.10.3720.10:FF:000030 Maltose ABC transporter permease MalF
1 95 Gene3D G3DSA:1.20.58.370 -
1 95 InterPro IPR035277 MalF, N-terminal
98 268 Gene3D G3DSA:3.10.650.10 -
261 503 SUPERFAMILY SSF161098 MetI-like
261 503 InterPro IPR035906 MetI-like superfamily
484 506 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
40 58 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
437 483 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
1 95 FunFam G3DSA:1.20.58.370:FF:000001 Maltose ABC transporter permease MalF
507 514 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
35 39 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
40 57 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.734
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.482
Likely same site as FPocket 25 2.1 Å 14 shared residues 93% of smaller site
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.308
Show in viewer
Surrounding area
Pocket 4 P2Rank #4
0.029
Show in viewer
Surrounding area
Pocket 5 P2Rank #5
0.026
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #25
0.51 Unusual size
Likely same site as P2Rank 2 2.1 Å 14 shared residues 93% of smaller site
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GGU7
AlphaFold DB — — full sequence — Viewing
ColabFold KP13_00371
ColabFold — — full sequence — Loaded

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Sequence

UniProt A0A0H3GGU7