KpKP13 Protein target profile

Trk system potassium uptake protein trkH

Accession: KP13_01745

Gene: AHE46952.1 trkH 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GLP4
Length 483
Pocket druggability (P2Rank · AlphaFold DB model) 0.729
Functional annotation 0 EC 8 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
3.0% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
95.652 Higher values support similarity to known essential genes.
DEG E-value
0.0 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
89.74 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.729
Structure A0A0H3GLP4
Pocket Pocket 1
Druggability (FPocket) 0.832
Structure A0A0H3GLP4
Pocket Pocket 8
ColabFold model
P2Rank 0.385 · Pocket 1
FPocket 0.806 · Pocket 1
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 141 / 4744 genomes with a hit
Prevalence 3.0%

Sequence

Primary amino-acid sequence viewer.

MHFRAITRIVGLLVILFSGTMIVPGLVALIYRDGAGRAFTQTFFVALAIGSMLWWPNRKQKGELKSREGFLIVVLFWTVLGSVGALPFIFSEQPNLTVTDAFFESFSGLTTTGATTLVGLDSLPHAILFYRQMLQWFGGMGIIVLAVAILPILGVGGMQLYRAEMPGPLKDNKMRPRIAETAKTLWLIYVLLTIACALALWFAGMPAFDAIGHSFATIAIGGFSTHDASVGYFNSPMINSIIAIFLLISGCNYGLHFSLLSGRSLKVYWRDPEFRMFIGVQLTLVIVCTLVLWLHNVYGSVLTTLNQAFFQVVSMATTAGFTTDSIARWPLFLPVLLLCSAFIGGCAGSTGGGLKVIRILLLFKQGNRELKRLVHPNAVYSIKLGNRALPERILEAVWGFFSAYALVFIISMLAIIATGVDDFSAFASVVATLNNLGPGLGVVADNFATMNPVAKWILIANMLFGRLEVFTLLVLFTPTFWRE

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

8 GO

Subcellular localization

Localization
CytoplasmicMembrane

Gene Ontology (GO)

8
  • GO:0006812 The directed movement of a monoatomic cation, into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore. Monatomic cations (also called simple cations) are positively charged ions consisting of exactly one atom.
  • GO:0071805 A process in which a potassium ion is transported from one side of a membrane to the other.
  • GO:0008324 Enables the transfer of cation from one side of a membrane to the other.
  • GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
  • GO:0015379 Enables the transfer of a solute or solutes from one side of a membrane to the other according to the reaction: K+(out) + Cl-(out) = K+(in) + Cl-(in).
  • GO:0055085 The process in which a solute is transported across a lipid bilayer, from one side of a membrane to the other.
  • GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
  • GO:0046872 Binding to a metal ion.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

40 records
Show feature table
Start End DB Term Name
256 275 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
364 395 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
418 422 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
276 295 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
69 91 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
136 163 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
37 477 Pfam PF02386 Cation transport protein
37 477 InterPro IPR003445 Cation transporter
133 155 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
332 354 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
12 32 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
396 418 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
277 299 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
445 455 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
69 90 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
237 255 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
58 68 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
331 363 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
1 483 PIRSF PIRSF006247 TrkH
1 483 InterPro IPR004772 TrkH potassium transport family
2 483 PANTHER PTHR32024 TRK SYSTEM POTASSIUM UPTAKE PROTEIN TRKG-RELATED
9 31 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
238 260 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
164 183 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
38 57 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
205 236 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
185 207 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
33 37 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
1 11 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
396 417 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
456 478 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
482 483 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
184 204 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
35 57 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
423 444 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
296 330 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
91 135 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
84 466 NCBIfam TIGR00933 TrkH family potassium uptake protein
84 466 InterPro IPR004772 TrkH potassium transport family
456 481 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.729
Likely same site as FPocket 16 0.1 Å 16 shared residues 100% of smaller site
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.554
Likely same site as FPocket 8 6.3 Å 14 shared residues 93% of smaller site
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.128
Show in viewer
Surrounding area
Pocket 4 P2Rank #4
0.093
Show in viewer
Surrounding area
Pocket 5 P2Rank #5
0.083
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #8
0.832 Unusual size
Likely same site as P2Rank 2 6.3 Å 14 shared residues 93% of smaller site
Show in viewer
Surrounding area
Pocket 2 FPocket #3
0.486
Show in viewer
Surrounding area
Pocket 3 FPocket #16
0.417
Likely same site as P2Rank 1 0.1 Å 16 shared residues 100% of smaller site
Show in viewer
Surrounding area
Residue sets
UniProt: Binding site:111-111
UniProt: Binding site:112-112
UniProt: Binding site:220-220
UniProt: Binding site:221-221
UniProt: Binding site:318-318
UniProt: Binding site:319-319
UniProt: Binding site:435-435
UniProt: Binding site:436-436
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GLP4
AlphaFold DB full sequence Viewing
ColabFold KP13_01745
ColabFold full sequence Loaded

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.