Protein target profile

KP13_01737

Deoxyribonuclease tatD

Genome: KpKP13 Gene: AHE46960.1 tatD 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GH78
Length 263
Pocket druggability 0.007
Direct ligand evidence 0 51 total records
Functional annotation 2 EC 6 GO
Target summary

Target candidate with partial support; inspect missing evidence before prioritizing.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
Hit
Human identity (%)
36.364 Lower values reduce human off-target concern.
Human E-value
3.42e-14
Gut microbiome similarity
2.4% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
0.0 Higher values support similarity to known essential genes.

Localization

Localization
Cytoplasmic

Structure confidence

ColabFold pLDDT
96.88 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

The selected pocket score is the FPocket value used for ranking after applying the curated structure priority. It estimates small-molecule pocket quality; it is not experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

FPocket 0.007
Structure A0A0H3GH78
Pocket Pocket 3
P2Rank 0.859
Structure A0A0H3GH78
Pocket Pocket 1
ColabFold model
FPocket 0.294 · Pocket 9
P2Rank 0.849 · Pocket 1
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 114 / 4744 genomes with a hit
Prevalence 2.4%

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Sequence

Primary amino-acid sequence viewer.

MFDIGVNLTSSQFSRDHDEVVARALAAGVNGMLLTGTNLAESQQAQKLASRYSGCWSTAGVHPHDGSSWTPAVAEAIYTLAGEPQVVAIGECGLDFNRNFSTPHEQEVAFSAQLALAAELSMPVFLHCRDAHDRFLTLLKPWLEKLPGAVLHCFTGSRSEVQECLDLGLFIGITGWVCDERRGLELRELLPAIPAERLLLETDAPYLLPRDLKPKPASRRNEPAYLPHILASVAAWRGEEAQWLEAQTDANVRALFGVDINGV

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

2 EC 6 GO

Enzyme Commission (EC)

2

Gene Ontology (GO)

6
  • GO:0016788 Catalysis of the hydrolysis of any ester bond.
  • GO:0008408 Catalysis of the hydrolysis of ester linkages within nucleic acids by removing nucleotide residues from the 3' end.
  • GO:0005829 The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
  • GO:0000175 Catalysis of the sequential cleavage of mononucleotides from a free 3' terminus of an RNA molecule.
  • GO:0000287 Binding to a magnesium (Mg) ion.
  • GO:0008310 Catalysis of the sequential cleavage of mononucleotides from a free 3' terminus of a single-stranded DNA molecule.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

17 records
Show feature table
Start End DB Term Name
1 262 Gene3D G3DSA:3.20.20.140 -
1 259 Hamap MF_00901 3'-5' ssDNA/RNA exonuclease TatD [tatD].
1 259 InterPro IPR024918 3'-5' ssDNA/RNA exonuclease TatD
1 257 CDD cd01310 TatD_DNAse
1 257 InterPro IPR001130 3'-5' ssDNA/RNA exonuclease TatD-like
1 260 PIRSF PIRSF005902 DNase_TatD
1 260 InterPro IPR001130 3'-5' ssDNA/RNA exonuclease TatD-like
123 133 ProSitePatterns PS01090 TatD deoxyribonuclease family signature 2.
123 133 InterPro IPR018228 Deoxyribonuclease, TatD-related, conserved site
1 260 FunFam G3DSA:3.20.20.140:FF:000018 3'-5' ssDNA/RNA exonuclease TatD
1 258 SUPERFAMILY SSF51556 Metallo-dependent hydrolases
1 258 InterPro IPR032466 Metal-dependent hydrolase
2 256 Pfam PF01026 TatD related DNase
2 256 InterPro IPR001130 3'-5' ssDNA/RNA exonuclease TatD-like
1 258 PANTHER PTHR46124 D-AMINOACYL-TRNA DEACYLASE
189 205 ProSitePatterns PS01091 TatD deoxyribonuclease family signature 3.
189 205 InterPro IPR018228 Deoxyribonuclease, TatD-related, conserved site

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Site 1 P2Rank #1
0.859
Show in viewer
Surrounding area
Site 2 P2Rank #2
0.073
Show in viewer
Surrounding area
Residue sets
UniProt: Binding site:131-131
UniProt: Binding site:156-156
UniProt: Binding site:207-207
UniProt: Binding site:95-95
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GH78
AlphaFold DB full sequence Viewing
ColabFold KP13_01737
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

51 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 1 records from similar proteins
Structural ligands 1 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
P33 PDB via homolog 326.4 Da · LogP -0.93 · TPSA 95.8 Open detail RCSB PDB
ZINC12501520 ZINC proposed compound · Tanimoto 1.000 Detail ZINC
ZINC3874716 ZINC proposed compound · Tanimoto 1.000 Detail ZINC
ZINC4283769 ZINC proposed compound · Tanimoto 1.000 Detail ZINC
ZINC4521548 ZINC proposed compound · Tanimoto 1.000 Detail ZINC

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
P33 RCSB PDB P39408 326.4 Da LogP -0.93 TPSA 95.8 ✓ Ro5 ✓ Clean C(COCCOCCOCCOCCOCCOCCO)O

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.