Protein target profile

KP13_01706

Porphobilinogen deaminase

Genome: KpKP13 Gene: AHE46988.1 hemC 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GKD9
Length 313
Pocket druggability 0.52
Direct ligand evidence 0 7 total records
Functional annotation 1 EC 5 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
Hit
Human identity (%)
47.312 Lower values reduce human off-target concern.
Human E-value
4.91e-50
Gut microbiome similarity
8.3% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
83.974 Higher values support similarity to known essential genes.
DEG E-value
0.0 Smaller values mean stronger essential-gene similarity.

Localization

Localization
Cytoplasmic

Structure confidence

ColabFold pLDDT
93.2 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

The selected pocket score is the FPocket value used for ranking after applying the curated structure priority. It estimates small-molecule pocket quality; it is not experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

FPocket 0.52
Structure A0A0H3GKD9
Pocket Pocket 6
P2Rank 0.942
Structure A0A0H3GKD9
Pocket Pocket 1
ColabFold model
FPocket 0.832 · Pocket 7
P2Rank 0.943 · Pocket 1
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 394 / 4744 genomes with a hit
Prevalence 8.3%

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Sequence

Primary amino-acid sequence viewer.

MLDKVLKIATRQSPLALWQAQYVKARLEQAHPGLKVELVPMVTRGDVILDTPLAKVGGKGLFVKELELAMLEGRADIAVHSMKDVPVEFPEGLGLVTICERDDPRDAFVSNRYASIDELPAGSVVGTSSLRRQCQLAATRPDLAIRSLRGNVGTRLSKLDNGEYDAIILAAAGLKRLQLEARIRQPLSPEQSLPAVGQGAVGIECRLDDAWTRGLLAPLNHTETAVRVRAERAMNTRLEGGCQVPIGSYAELKDGELWLRALVGAPDGSQLVRGERRGPAEQAEALGISLAEELLDNGAREILAAVYDGEAPR

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 5 GO

Enzyme Commission (EC)

1

Gene Ontology (GO)

5
  • GO:0004418 Catalysis of the reaction: H2O + 4 porphobilinogen = hydroxymethylbilane + 4 NH4.
  • GO:0033014 The chemical reactions and pathways leading to the formation of tetrapyrroles, natural pigments containing four pyrrole rings joined by one-carbon units linking position 2 of one pyrrole ring to position 5 of the next.
  • GO:0018160 The covalent binding of a pyrromethane (dipyrrin) cofactor to protein via the sulfur atom of cysteine forming dipyrrolylmethanemethyl-L-cysteine.
  • GO:0005737 The contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
  • GO:0006782 The chemical reactions and pathways resulting in the formation of protoporphyrinogen IX.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

35 records
Show feature table
Start End DB Term Name
1 311 PIRSF PIRSF001438 PBGD
1 311 InterPro IPR000860 Porphobilinogen deaminase
5 297 Hamap MF_00260 Porphobilinogen deaminase [hemC].
5 297 InterPro IPR000860 Porphobilinogen deaminase
6 209 Gene3D G3DSA:3.40.190.10 -
103 202 Gene3D G3DSA:3.40.190.10 -
221 309 Gene3D G3DSA:3.30.160.40 -
221 309 InterPro IPR036803 Porphobilinogen deaminase, C-terminal domain superfamily
6 212 Pfam PF01379 Porphobilinogen deaminase, dipyromethane cofactor binding domain
6 212 InterPro IPR022417 Porphobilinogen deaminase, N-terminal
221 310 FunFam G3DSA:3.30.160.40:FF:000002 Porphobilinogen deaminase
5 219 SUPERFAMILY SSF53850 Periplasmic binding protein-like II
45 65 PRINTS PR00151 Porphobilinogen deaminase signature
45 65 InterPro IPR000860 Porphobilinogen deaminase
230 247 PRINTS PR00151 Porphobilinogen deaminase signature
230 247 InterPro IPR000860 Porphobilinogen deaminase
76 95 PRINTS PR00151 Porphobilinogen deaminase signature
76 95 InterPro IPR000860 Porphobilinogen deaminase
124 141 PRINTS PR00151 Porphobilinogen deaminase signature
124 141 InterPro IPR000860 Porphobilinogen deaminase
143 160 PRINTS PR00151 Porphobilinogen deaminase signature
143 160 InterPro IPR000860 Porphobilinogen deaminase
6 103 FunFam G3DSA:3.40.190.10:FF:000004 Porphobilinogen deaminase
226 295 Pfam PF03900 Porphobilinogen deaminase, C-terminal domain
226 295 InterPro IPR022418 Porphobilinogen deaminase, C-terminal
220 308 SUPERFAMILY SSF54782 Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain
220 308 InterPro IPR036803 Porphobilinogen deaminase, C-terminal domain superfamily
104 202 FunFam G3DSA:3.40.190.10:FF:000005 Porphobilinogen deaminase
6 278 CDD cd13646 PBP2_EcHMBS_like
231 247 ProSitePatterns PS00533 Porphobilinogen deaminase cofactor-binding site.
231 247 InterPro IPR022419 Porphobilinogen deaminase, dipyrromethane cofactor binding site
6 297 NCBIfam TIGR00212 hydroxymethylbilane synthase
6 297 InterPro IPR000860 Porphobilinogen deaminase
4 306 PANTHER PTHR11557 PORPHOBILINOGEN DEAMINASE
4 306 InterPro IPR000860 Porphobilinogen deaminase

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · FPocket

Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Site 1 FPocket #6
0.52
Show in viewer
Surrounding area

Binding pockets · P2Rank

Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Site 1 P2Rank #1
0.942
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GKD9
AlphaFold DB full sequence Viewing
ColabFold KP13_01706
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

7 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 6 records from similar proteins
Structural ligands 6 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 1 similarity-based ZINC candidates
Best available ligand signal
18W PDB via homolog 434.4 Da · LogP 1.07 · TPSA 194.1 Open detail RCSB PDB
29P PDB via homolog Detail RCSB PDB
7J8 PDB via homolog Detail RCSB PDB
AWQ PDB via homolog Detail RCSB PDB
DPM PDB via homolog Detail RCSB PDB

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
18W RCSB PDB Q43316 434.4 Da LogP 1.07 TPSA 194.1 1 viol. ✓ Clean Cc1c(c(c([nH]1)/C=C\2/C(=C(C(=O)N2)CCC(=O)O)CC(…
29P RCSB PDB Q8GCA8 436.4 Da LogP 0.64 TPSA 194.1 1 viol. ✓ Clean Cc1c(c(c([nH]1)C[C@H]2C(=C(C(=O)N2)CCC(=O)O)CC(…
7J8 RCSB PDB P08397 838.8 Da LogP 2.66 TPSA 361.6 2 viol. ✓ Clean Cc1c(c(c([nH]1)Cc2c(c(c([nH]2)Cc3c(c(c([nH]3)Cc…
AWQ RCSB PDB Q8GCA8 225.2 Da LogP 1.28 TPSA 90.4 ✓ Ro5 ✓ Clean Cc1c(c(c([nH]1)C)CC(=O)O)CCC(=O)O
DPM RCSB PDB P06983 420.4 Da LogP 1.53 TPSA 180.8 1 viol. ✓ Clean Cc1c(c(c([nH]1)Cc2c(c(c[nH]2)CCC(=O)O)CC(=O)O)C…
FWL RCSB PDB P08397 352.1 Da LogP 0.72 TPSA 116.4 ✓ Ro5 ✓ Clean C(CC(=O)O)c1c(c([nH]c1I)CN)CC(=O)O

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.