Target candidate with partial support; inspect missing evidence before prioritizing.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- Hit
- Human identity (%)
- 38.22 Lower values reduce human off-target concern.
- Human E-value
- 3.5199999999999996e-24
- Gut microbiome similarity
- 3.2% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- Y
- DEG identity (%)
- 41.667 Higher values support similarity to known essential genes.
- DEG E-value
- 4.1800000000000005e-73 Smaller values mean stronger essential-gene similarity.
Structure confidence
- ColabFold pLDDT
- 95.98 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MSFFHANQREALNQSLAEVQGQINVSFEFFPPRTSEMEQTLWKSIDRLSSLKPKFVSVTYGANSGERDRTHSIIKGIKERTGLEAAPHLTCIDASRDELRTIAQDYWNNGIRHIVALRGDLPPGSGKPDMYAADLVTLLKEVGDFDISVAAYPEVHPEAKSAQADLLNLKRKVEAGANRAITQFFFDVESYLRFRDRCVSAGIDVEIIPGILPVSNFKQAKKFADMTNVRIPVWMSKMFEGLDNDAETRQLVGANIAMDMVKILSREGVKDFHFYTLNRAEMSYAICHTLGVRPA
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- Cytoplasmic
Enzyme Commission (EC)
1Gene Ontology (GO)
7- GO:0006555 The chemical reactions and pathways involving L-methionine (2-amino-4-(methylthio)butanoic acid), a sulfur-containing, essential amino acid found in peptide linkage in proteins.
- GO:0005829 The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
- GO:0009086 OBSOLETE. The chemical reactions and pathways resulting in the de novo formation of L-methionine (2-amino-4-(methylthio)butanoic acid), a sulfur-containing, essential amino acid found in peptide linkage in proteins.
- GO:0004489 Catalysis of the reaction: 5-methyltetrahydrofolate + NAD(P)+ = 5,10-methylenetetrahydrofolate + NAD(P)H + H+.
- GO:0071949 Binding to the oxidized form, FAD, of flavin-adenine dinucleotide, the coenzyme or the prosthetic group of various flavoprotein oxidoreductase enzymes.
- GO:0106312 Catalysis of the reaction: (6S)-5-methyl-5,6,7,8-tetrahydrofolate + NAD+ = (6R)-5,10-methylene-5,6,7,8-tetrahydrofolate + NADH + H+.
- GO:0035999 The chemical reactions and pathways by which one-carbon (C1) units are transferred between tetrahydrofolate molecules, to synthesize other tetrahydrofolate molecules.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 1 | 295 | FunFam | G3DSA:3.20.20.220:FF:000001 | Methylenetetrahydrofolate reductase |
| 22 | 294 | SUPERFAMILY | SSF51730 | FAD-linked oxidoreductase |
| 22 | 294 | InterPro | IPR029041 | FAD-linked oxidoreductase-like |
| 19 | 292 | PANTHER | PTHR45754 | METHYLENETETRAHYDROFOLATE REDUCTASE |
| 25 | 290 | NCBIfam | TIGR00676 | methylenetetrahydrofolate reductase [NAD(P)H] |
| 25 | 290 | InterPro | IPR004620 | 5,10-methylenetetrahydrofolate reductase |
| 1 | 295 | Gene3D | G3DSA:3.20.20.220 | - |
| 16 | 291 | Pfam | PF02219 | Methylenetetrahydrofolate reductase |
| 16 | 291 | InterPro | IPR003171 | Methylenetetrahydrofolate reductase-like |
| 25 | 290 | CDD | cd00537 | MTHFR |
| 25 | 290 | InterPro | IPR003171 | Methylenetetrahydrofolate reductase-like |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GGD2
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
KP13_00564
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural ligand evidence is available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| 4HF RCSB PDB | P0AEZ1 | 449.5 Da LogP 0.68 TPSA 187.5 | 1 viol. | ✓ Clean |
c1cc(sc1CC[C@@H]2CC3=C(NC2)N=C(NC3=O)N)C(=O)N[C…
|
|
| C2F RCSB PDB | P0AEZ1 | 459.5 Da LogP -0.26 TPSA 202.8 | 1 viol. | ✓ Clean |
C[N@@]1[C@H](CNC2=C1C(=O)NC(=N2)N)CNc3ccc(cc3)C…
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC1543800 ZINC | 1.000 | 449.5 Da LogP 0.68 TPSA 187.5 | 1 viol. | ✓ Clean |
Nc1nc2c(c(=O)[nH]1)C[C@@H](CCc1ccc(C(=O)N[C@@H]…
|
| ZINC2005305 ZINC | 1.000 | 459.5 Da LogP -0.26 TPSA 202.8 | 1 viol. | ✓ Clean |
CN1c2c(nc(N)[nH]c2=O)NC[C@@H]1CNc1ccc(C(=O)N[C@…
|
| ZINC2572666 ZINC | 1.000 | 459.5 Da LogP -0.26 TPSA 202.8 | 1 viol. | ✓ Clean |
CN1c2c(nc(N)[nH]c2=O)NC[C@H]1CNc1ccc(C(=O)N[C@@…
|
| ZINC3806974 ZINC | 1.000 | 449.5 Da LogP 0.68 TPSA 187.5 | 1 viol. | ✓ Clean |
Nc1nc2c(c(=O)[nH]1)C[C@H](CCc1ccc(C(=O)N[C@@H](…
|
| ZINC4228266 ZINC | 1.000 | 459.5 Da LogP -0.26 TPSA 202.8 | 1 viol. | ✓ Clean |
CN1c2c(nc(N)[nH]c2=O)NC[C@@H]1CNc1ccc(C(=O)N[C@…
|
| ZINC4228267 ZINC | 1.000 | 459.5 Da LogP -0.26 TPSA 202.8 | 1 viol. | ✓ Clean |
CN1c2c(nc(N)[nH]c2=O)NC[C@H]1CNc1ccc(C(=O)N[C@H…
|
| ZINC9212425 ZINC | 0.803 | 473.4 Da LogP -0.73 TPSA 219.8 | 1 viol. | ✓ Clean |
Nc1nc2c(c(=O)[nH]1)N(C=O)[C@@H](CNc1ccc(C(=O)N[…
|
| ZINC9212426 ZINC | 0.803 | 473.4 Da LogP -0.73 TPSA 219.8 | 1 viol. | ✓ Clean |
Nc1nc2c(c(=O)[nH]1)N(C=O)[C@H](CNc1ccc(C(=O)N[C…
|
| ZINC9212427 ZINC | 0.803 | 473.4 Da LogP -0.73 TPSA 219.8 | 1 viol. | ✓ Clean |
Nc1nc2c(c(=O)[nH]1)N(C=O)[C@@H](CNc1ccc(C(=O)N[…
|
| ZINC9212428 ZINC | 0.803 | 473.4 Da LogP -0.73 TPSA 219.8 | 1 viol. | ✓ Clean |
Nc1nc2c(c(=O)[nH]1)N(C=O)[C@H](CNc1ccc(C(=O)N[C…
|
| ZINC4658141 ZINC | 0.754 | 443.5 Da LogP 0.62 TPSA 187.5 | 1 viol. | ✓ Clean |
Nc1nc2c(c(=O)[nH]1)C[C@H](CCc1ccc(C(=O)N[C@H](C…
|
| ZINC4658144 ZINC | 0.754 | 443.5 Da LogP 0.62 TPSA 187.5 | 1 viol. | ✓ Clean |
Nc1nc2c(c(=O)[nH]1)C[C@@H](CCc1ccc(C(=O)N[C@H](…
|
| ZINC3806987 ZINC | 0.746 | 467.5 Da LogP 0.98 TPSA 187.5 | 1 viol. | ✓ Clean |
Nc1nc2c(c(=O)[nH]1)S[C@@H](CCc1ccc(C(=O)N[C@@H]…
|
| ZINC4846117 ZINC | 0.740 | 463.5 Da LogP 0.99 TPSA 187.5 | 1 viol. | ✓ Clean |
Cc1cc(C(=O)N[C@@H](CCC(=O)O)C(=O)O)sc1CC[C@@H]1…
|
| ZINC3806981 ZINC | 0.736 | 433.4 Da LogP 0.21 TPSA 200.6 | 1 viol. | ✓ Clean |
Nc1nc2c(c(=O)[nH]1)C[C@@H](CCc1ccc(C(=O)N[C@@H]…
|
| ZINC98207756 ZINC | 0.727 | 330.3 Da LogP 0.39 TPSA 136.4 | ✓ Ro5 | ✓ Clean |
CN1c2c(nc(N)[nH]c2=O)NC[C@@H]1CNc1ccc(C(=O)O)cc1
|
| ZINC8655682 ZINC | 0.711 | 487.5 Da LogP -0.34 TPSA 219.8 | 1 viol. | ✓ Clean |
Nc1nc2c(c(=O)[nH]1)N(C=O)[C@@H](CCNc1ccc(C(=O)N…
|
| ZINC4228235 ZINC | 0.708 | 445.4 Da LogP -0.28 TPSA 211.6 | 1 viol. | ✓ Clean |
Nc1nc2c(c(=O)[nH]1)N[C@H](CNc1ccc(C(=O)N[C@@H](…
|
| ZINC4228236 ZINC | 0.708 | 445.4 Da LogP -0.28 TPSA 211.6 | 1 viol. | ✓ Clean |
Nc1nc2c(c(=O)[nH]1)N[C@H](CNc1ccc(C(=O)N[C@H](C…
|
| ZINC4228237 ZINC | 0.708 | 445.4 Da LogP -0.28 TPSA 211.6 | 1 viol. | ✓ Clean |
Nc1nc2c(c(=O)[nH]1)N[C@@H](CNc1ccc(C(=O)N[C@@H]…
|
| ZINC4228238 ZINC | 0.708 | 445.4 Da LogP -0.28 TPSA 211.6 | 1 viol. | ✓ Clean |
Nc1nc2c(c(=O)[nH]1)N[C@@H](CNc1ccc(C(=O)N[C@H](…
|
| ZINC1532902 ZINC | 0.700 | 206.2 Da LogP -0.86 TPSA 132.1 | ✓ Ro5 | ✓ Clean |
O=C(O)CC[C@@](O)(CC(=O)O)C(=O)O
|
| ZINC2018106 ZINC | 0.700 | 206.2 Da LogP -0.86 TPSA 132.1 | ✓ Ro5 | ✓ Clean |
O=C(O)CC[C@](O)(CC(=O)O)C(=O)O
|
| ZINC8628600 ZINC | 0.671 | 473.5 Da LogP 0.13 TPSA 202.8 | 1 viol. | ✓ Clean |
CN1c2c([nH]c(N)nc2=O)NC[C@@H]1CCNc1ccc(C(=O)N[C…
|
| ZINC8628601 ZINC | 0.671 | 473.5 Da LogP 0.13 TPSA 202.8 | 1 viol. | ✓ Clean |
CN1c2c([nH]c(N)nc2=O)NC[C@H]1CCNc1ccc(C(=O)N[C@…
|
| ZINC3593496 ZINC | 0.652 | 206.2 Da LogP -1.16 TPSA 121.1 | ✓ Ro5 | ✓ Clean |
COC(=O)C[C@@](O)(CC(=O)O)C(=O)O
|
| ZINC3593497 ZINC | 0.652 | 206.2 Da LogP -1.16 TPSA 121.1 | ✓ Ro5 | ✓ Clean |
COC(=O)C[C@](O)(CC(=O)O)C(=O)O
|
| ZINC4228243 ZINC | 0.645 | 457.4 Da LogP -0.52 TPSA 194.0 | 1 viol. | ✓ Clean |
Nc1nc2c(c(=O)[nH]1)N1CN(c3ccc(C(=O)N[C@@H](CCC(…
|
| ZINC4228244 ZINC | 0.645 | 457.4 Da LogP -0.52 TPSA 194.0 | 1 viol. | ✓ Clean |
Nc1nc2c(c(=O)[nH]1)N1CN(c3ccc(C(=O)N[C@H](CCC(=…
|
| ZINC4654260 ZINC | 0.645 | 457.4 Da LogP -0.52 TPSA 194.0 | 1 viol. | ✓ Clean |
Nc1nc2c(c(=O)[nH]1)N1CN(c3ccc(C(=O)N[C@@H](CCC(…
|
| ZINC8618631 ZINC | 0.645 | 459.5 Da LogP 0.11 TPSA 211.6 | 1 viol. | ✓ Clean |
Nc1nc2c(c(=O)[nH]1)N[C@H](CCNc1ccc(C(=O)N[C@@H]…
|
| ZINC8627114 ZINC | 0.645 | 459.5 Da LogP 0.11 TPSA 211.6 | 1 viol. | ✓ Clean |
Nc1nc2c(c(=O)[nH]1)N[C@@H](CCNc1ccc(C(=O)N[C@@H…
|
| ZINC4654270 ZINC | 0.632 | 471.4 Da LogP -0.36 TPSA 211.0 | 1 viol. | ✓ Clean |
Nc1nc2c(c(=O)[nH]1)N1C(=O)N(c3ccc(C(=O)N[C@@H](…
|
| ZINC4654271 ZINC | 0.632 | 471.4 Da LogP -0.36 TPSA 211.0 | 1 viol. | ✓ Clean |
Nc1nc2c(c(=O)[nH]1)N1C(=O)N(c3ccc(C(=O)N[C@@H](…
|
| ZINC14686440 ZINC | 0.625 | 436.4 Da LogP -2.64 TPSA 247.9 | 1 viol. | ✓ Clean |
O=C(O)C[C@](O)(CC(=O)NCCCCNC(=O)C[C@@](O)(CC(=O…
|
| ZINC14686442 ZINC | 0.625 | 436.4 Da LogP -2.64 TPSA 247.9 | 1 viol. | ✓ Clean |
O=C(O)C[C@@](O)(CC(=O)NCCCCNC(=O)C[C@](O)(CC(=O…
|
| ZINC14686444 ZINC | 0.625 | 436.4 Da LogP -2.64 TPSA 247.9 | 1 viol. | ✓ Clean |
O=C(O)C[C@@](O)(CC(=O)NCCCCNC(=O)C[C@@](O)(CC(=…
|
| ZINC4228265 ZINC | 0.605 | 443.4 Da LogP 0.01 TPSA 211.9 | 1 viol. | ✓ Clean |
Nc1nc2c(c(=O)[nH]1)N=C(CNc1ccc(C(=O)N[C@@H](CCC…
|
| ZINC4517559 ZINC | 0.605 | 443.4 Da LogP 0.01 TPSA 211.9 | 1 viol. | ✓ Clean |
Nc1nc2c(c(=O)[nH]1)N=C(CNc1ccc(C(=O)N[C@H](CCC(…
|
| ZINC13887836 ZINC | 0.600 | 429.4 Da LogP 0.54 TPSA 187.5 | 1 viol. | ✓ Clean |
Nc1nc2c(c(=O)[nH]1)[C@@H](CCc1ccc(C(=O)N[C@@H](…
|
| ZINC1637602 ZINC | 0.587 | 443.5 Da LogP 0.62 TPSA 187.5 | 1 viol. | ✓ Clean |
Nc1nc(=O)c2c([nH]1)NC[C@@H](CCc1ccc(C(=O)N[C@@H…
|
| ZINC8997303 ZINC | 0.585 | 487.5 Da LogP 0.07 TPSA 220.1 | 1 viol. | ✓ Clean |
Nc1nc(O)c2c(n1)NC[C@@H](CNc1ccc(C(=O)N[C@@H](CC…
|
| ZINC8997304 ZINC | 0.585 | 487.5 Da LogP 0.07 TPSA 220.1 | 1 viol. | ✓ Clean |
Nc1nc(O)c2c(n1)NC[C@@H](CNc1ccc(C(=O)N[C@H](CCC…
|
| ZINC8997305 ZINC | 0.585 | 487.5 Da LogP 0.07 TPSA 220.1 | 1 viol. | ✓ Clean |
Nc1nc(O)c2c(n1)NC[C@H](CNc1ccc(C(=O)N[C@@H](CCC…
|
| ZINC8997306 ZINC | 0.585 | 487.5 Da LogP 0.07 TPSA 220.1 | 1 viol. | ✓ Clean |
Nc1nc(O)c2c(n1)NC[C@H](CNc1ccc(C(=O)N[C@H](CCCC…
|
| ZINC72124809 ZINC | 0.579 | 447.5 Da LogP 1.12 TPSA 191.3 | 1 viol. | ✓ Clean |
Nc1nc2[nH]c(CCCc3ccc(C(=O)N[C@@H](CCC(=O)O)C(=O…
|
| ZINC13398039 ZINC | 0.577 | 234.2 Da LogP -0.38 TPSA 121.1 | ✓ Ro5 | ✓ Clean |
CC(C)OC(=O)C[C@](O)(CC(=O)O)C(=O)O
|
| ZINC2528012 ZINC | 0.577 | 234.2 Da LogP -0.38 TPSA 121.1 | ✓ Ro5 | ✓ Clean |
CC(C)OC(=O)C[C@@](O)(CC(=O)O)C(=O)O
|
| ZINC6142389 ZINC | 0.570 | 433.4 Da LogP 0.21 TPSA 200.6 | 1 viol. | ✓ Clean |
Nc1nc(=O)c2c([nH]1)NC[C@@H](CCc1ccc(C(=O)N[C@@H…
|
| ZINC4228269 ZINC | 0.563 | 456.4 Da LogP -0.61 TPSA 193.7 | 1 viol. | ✓ Clean |
Nc1nc2c(c(=O)[nH]1)[N+]1=CN(c3ccc(C(=O)N[C@@H](…
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.