Protein target profile

KP13_00599

L-rhamnose mutarotase

Genome: KpKP13 Gene: rhaM AHE47074.1 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GG98
Length 104
Pocket druggability 0.044
Direct ligand evidence 0 53 total records
Functional annotation 1 EC 5 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
2.0% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
0.0 Higher values support similarity to known essential genes.

Localization

Localization
Unknown

Structure confidence

ColabFold pLDDT
98.35 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

The selected pocket score is the FPocket value used for ranking after applying the curated structure priority. It estimates small-molecule pocket quality; it is not experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

FPocket 0.044
Structure A0A0H3GG98
Pocket Pocket 1
P2Rank 0.948
Structure A0A0H3GG98
Pocket Pocket 1
ColabFold model
FPocket 0.188 · Pocket 1
P2Rank 0.945 · Pocket 1
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 97 / 4744 genomes with a hit
Prevalence 2.0%

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Sequence

Primary amino-acid sequence viewer.

MIRKAFVMQVNPDAHEEYQRRHNPIWPELEAVLKAHGAHHYAIYLDKERHLLFATVEIESEARWEAVASTEVCQRWWKYMREVMPSNPDNSPLSAELKEVFYLA

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 5 GO

Enzyme Commission (EC)

1

Gene Ontology (GO)

5
  • GO:0005737 The contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
  • GO:0016857 Catalysis of a reaction that alters the configuration of one or more chiral centers in a carbohydrate molecule.
  • GO:0019299 OBSOLETE. The chemical reactions and pathways involving rhamnose, the hexose 6-deoxy-L-mannose. Rhamnose occurs commonly as a compound of plant glycosides, in polysaccharides of gums and mucilages, and in bacterial polysaccharides. It is also a component of some plant cell wall polysaccharides and frequently acts as the sugar components of flavonoids.
  • GO:0062192 Catalysis of the reaction: alpha-L-rhamnose = beta-L-rhamnose.
  • GO:0019301 The chemical reactions and pathways resulting in the breakdown of rhamnose, the hexose 6-deoxy-L-mannose.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

10 records
Show feature table
Start End DB Term Name
1 104 Hamap MF_01663 L-rhamnose mutarotase [rhaM].
1 104 InterPro IPR013448 L-rhamnose mutarotase
3 103 NCBIfam TIGR02625 L-rhamnose mutarotase
3 103 InterPro IPR013448 L-rhamnose mutarotase
1 97 Gene3D G3DSA:3.30.70.100 -
2 103 PANTHER PTHR34389 L-RHAMNOSE MUTAROTASE
3 103 Pfam PF05336 L-rhamnose mutarotase
3 103 InterPro IPR008000 Rhamnose/fucose mutarotase
1 103 SUPERFAMILY SSF54909 Dimeric alpha+beta barrel
1 103 InterPro IPR011008 Dimeric alpha-beta barrel

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Site 1 P2Rank #1
0.948
Show in viewer
Surrounding area
Residue sets
UniProt: Active site:22-22 Proton donor
UniProt: Binding site:18-18
UniProt: Binding site:41-41
UniProt: Binding site:76-77
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GG98
AlphaFold DB full sequence Viewing
ColabFold KP13_00599
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

53 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 3 records from similar proteins
Structural ligands 3 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
1PG PDB via homolog 252.3 Da · LogP -0.31 · TPSA 66.4 Open detail RCSB PDB
RM4 PDB via homolog Detail RCSB PDB
RNS PDB via homolog Detail RCSB PDB
ZINC1580161 ZINC proposed compound · Tanimoto 1.000 Detail ZINC
ZINC16052118 ZINC proposed compound · Tanimoto 1.000 Detail ZINC

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
1PG RCSB PDB F0Q4R9 252.3 Da LogP -0.31 TPSA 66.4 ✓ Ro5 ✓ Clean COCCOCCOCCOCCOCCO
RM4 RCSB PDB Q7BSH1 164.2 Da LogP -2.19 TPSA 90.2 ✓ Ro5 ✓ Clean C[C@H]1[C@@H]([C@H]([C@H]([C@H](O1)O)O)O)O
RNS RCSB PDB P32156 164.2 Da LogP -2.35 TPSA 98.0 ✓ Ro5 ✓ Clean C[C@@H]([C@@H]([C@H]([C@H](C=O)O)O)O)O

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.