KpKP13 Protein target profile

Nitrogen regulation protein ntrB

Accession: KP13_00623

Gene: AHE47097.1 ntrB 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GPJ3
Length 349
Pocket druggability (P2Rank · AlphaFold DB model) 0.811
Direct ligand evidence 0 54 total records
Functional annotation 0 EC 5 GO
Target summary

Strong target candidate with converging metabolic, structural and chemical evidence.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
2.6% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
93.41 Higher values support similarity to known essential genes.
DEG E-value
0.0 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
88.51 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.811
Structure A0A0H3GPJ3
Pocket Pocket 1
Druggability (FPocket) 0.823
Structure A0A0H3GPJ3
Pocket Pocket 2
ColabFold model
P2Rank 0.811 · Pocket 1
FPocket 0.23 · Pocket 20
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 124 / 4744 genomes with a hit
Prevalence 2.6%

Sequence

Primary amino-acid sequence viewer.

MATGTLPDAGQILNSLINSILLVDDDLAVHFANPAAQQLLAQSSRKLFGTPLPELLSYFSLNIGLMQESLQAGQGFTDNEVTLVIDGRSHILSLTAQRLPEGFILLEMAPMDNQRRLSQEQLQHAQQVAARDLVRGLAHEIKNPLGGLRGAAQLLSKALPDPALTEYTKVIIEQADRLRNLVDRLLGPQHPGMHVTESIHKVAERVVKLVSMELPDNVKLIRDYDPSLPELPHDPDQIEQVLLNIVRNALQALGPEGGEIILRTRTAFQLTLHGVRYRLAARIDVEDNGPGIPPHLQDTLFYPMVSGREGGTGLGLSIARSLIDQHSGKIEFTSWPGHTEFSVYLPIRK

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

5 GO

Subcellular localization

Localization
CytoplasmicMembrane

Gene Ontology (GO)

5
  • GO:0016310 The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
  • GO:0006355 Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
  • GO:0016772 Catalysis of the transfer of a phosphorus-containing group from one compound (donor) to another (acceptor).
  • GO:0000155 Catalysis of the phosphorylation of a histidine residue in response to detection of an extracellular signal such as a chemical ligand or change in environment, to initiate a change in cell state or activity. The two-component sensor is a histidine kinase that autophosphorylates a histidine residue in its active site. The phosphate is then transferred to an aspartate residue in a downstream response regulator, to trigger a response.
  • GO:0007165 The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

37 records
Show feature table
Start End DB Term Name
11 104 SUPERFAMILY SSF55785 PYP-like sensor domain (PAS domain)
11 104 InterPro IPR035965 PAS domain superfamily
9 112 Gene3D G3DSA:3.30.450.20 PAS domain
136 349 ProSiteProfiles PS50109 Histidine kinase domain profile.
136 349 InterPro IPR005467 Histidine kinase domain
191 349 FunFam G3DSA:3.30.565.10:FF:000008 Nitrogen regulation histidine kinase
131 186 Pfam PF00512 His Kinase A (phospho-acceptor) domain
131 186 InterPro IPR003661 Signal transduction histidine kinase, dimerisation/phosphoacceptor domain
16 102 CDD cd00130 PAS
16 102 InterPro IPR000014 PAS domain
238 346 CDD cd16918 HATPase_Glnl-NtrB-like
131 186 CDD cd00082 HisKA
234 347 Pfam PF02518 Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
234 347 InterPro IPR003594 Histidine kinase/HSP90-like ATPase
115 190 FunFam G3DSA:1.10.287.130:FF:000005 Nitrogen regulation histidine kinase
116 190 Gene3D G3DSA:1.10.287.130 -
281 295 PRINTS PR00344 Bacterial sensor protein C-terminal signature
281 295 InterPro IPR004358 Signal transduction histidine kinase-related protein, C-terminal
310 328 PRINTS PR00344 Bacterial sensor protein C-terminal signature
310 328 InterPro IPR004358 Signal transduction histidine kinase-related protein, C-terminal
333 346 PRINTS PR00344 Bacterial sensor protein C-terminal signature
333 346 InterPro IPR004358 Signal transduction histidine kinase-related protein, C-terminal
233 349 SMART SM00387 HKATPase_4
233 349 InterPro IPR003594 Histidine kinase/HSP90-like ATPase
12 348 PANTHER PTHR43065 SENSOR HISTIDINE KINASE
7 75 SMART SM00091 pas_2
7 75 InterPro IPR000014 PAS domain
11 97 Pfam PF00989 PAS fold
11 97 InterPro IPR013767 PAS fold
129 194 SMART SM00388 HisKA_10
129 194 InterPro IPR003661 Signal transduction histidine kinase, dimerisation/phosphoacceptor domain
121 186 SUPERFAMILY SSF47384 Homodimeric domain of signal transducing histidine kinase
121 186 InterPro IPR036097 Signal transduction histidine kinase, dimerisation/phosphoacceptor domain superfamily
191 349 Gene3D G3DSA:3.30.565.10 -
191 349 InterPro IPR036890 Histidine kinase/HSP90-like ATPase superfamily
198 346 SUPERFAMILY SSF55874 ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase
198 346 InterPro IPR036890 Histidine kinase/HSP90-like ATPase superfamily

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.811
Likely same site as FPocket 2 1.8 Å 23 shared residues 100% of smaller site
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.12
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.071
Show in viewer
Surrounding area
Pocket 4 P2Rank #4
0.065
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #2
0.823 Unusual size
Likely same site as P2Rank 1 1.8 Å 23 shared residues 100% of smaller site
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GPJ3
AlphaFold DB full sequence Viewing
ColabFold KP13_00623
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

54 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 4 records from similar proteins
Structural ligands 4 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
ANP PDB via homolog 506.2 Da · LogP -2.06 · TPSA 281.9 Open detail RCSB PDB
C2E PDB via homolog Detail RCSB PDB
EMC PDB via homolog Detail RCSB PDB
EMT PDB via homolog Detail RCSB PDB
ZINC12501894 ZINC proposed compound · Tanimoto 1.000 Detail ZINC

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
ANP RCSB PDB P0AE82 506.2 Da LogP -2.06 TPSA 281.9 3 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
C2E RCSB PDB Q9X688 690.4 Da LogP -3.05 TPSA 349.6 3 viol. ✓ Clean c1nc2c(n1[C@H]3[C@@H]([C@H]4[C@H](O3)CO[P@@](=O…
EMC RCSB PDB Q9X180 229.7 Da LogP 0.97 TPSA 0.0 ✓ Ro5 ✓ Clean CC[Hg+]
EMT RCSB PDB Q9X180 382.8 Da LogP 2.91 TPSA 37.3 ✓ Ro5 ✓ Clean CC[Hg]Sc1ccccc1C(=O)O

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.