Protein target profile

KP13_32246

Streptothricin acetyltransferase

Genome: KpKP13 Gene: AHE41864.1 sat 3D evidence: ColabFold model UniProt A0ACC7Q4W8
Export view
Length 174
Pocket druggability 0.515
Direct ligand evidence 0 16 total records
Functional annotation 0 EC 1 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Main supporting evidence

No similar human protein detected The current BLAST sequence screen did not find a significant human match, lowering apparent off-target risk. Moderate predicted binding pocket FPocket selected-pocket score 0.52. This supports review but is not experimental validation. Second pocket predictor agrees P2Rank predicted binding-site probability 0.87. Structure available ColabFold model Review the complete evidence below

Risks to review

Microbiome similarity 1 of 4744 screened genomes (0.0%) have a significant similarity hit. This target also has a predicted binding pocket (FPocket 0.52) — check the ligand evidence before deprioritizing on off-target risk alone. Mixed conservation Core/accessory calls are not fully concordant.

Evidence gaps

No metabolic context No SBML/network-derived reaction evidence is loaded for this protein.
Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
0.0% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
0.0 Higher values support similarity to known essential genes.

Localization

Localization
Unknown

Structure confidence

ColabFold pLDDT
93.08 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

ColabFold / curated model

The selected pocket score is the FPocket value used for ranking after applying the curated structure priority. It estimates small-molecule pocket quality; it is not experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

FPocket 0.515
Structure CB_KP13_32246
Pocket Pocket 1
P2Rank 0.868
Structure CB_KP13_32246
Pocket Pocket 1
ColabFold model
FPocket 0.515 · Pocket 1
P2Rank 0.868 · Pocket 1
Core conservation Accessory gene
Roary accessory
CoreCruncher accessory
Gut microbiome 1 / 4744 genomes with a hit
Prevalence 0.0%

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Sequence

UniProt A0ACC7Q4W8

Sequence

Primary amino-acid sequence viewer.

MKISVIPEQVAETLDAENHFIVREVFDVHLSDQGFELSTRSVSPYRKDYISDDDSDEDSACYGAFIDQELVGKIELNSTWNDLASIEHIVVSHTHRGKGVAHSLIEFAKKWALSRQLLGIRLETQTNNVPACNLYAKCGFTLGGIDLFTYKTRPQVSNETAMYWYWFSGAQDDA

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 GO

Gene Ontology (GO)

1
  • GO:0016747 Catalysis of the transfer of an acyl group, other than amino-acyl, from one compound (donor) to another (acceptor).

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

17 records
Show feature table
Start End DB Term Name
20 170 ProSiteProfiles PS51186 Gcn5-related N-acetyltransferase (GNAT) domain profile.
20 170 InterPro IPR000182 GNAT domain
5 167 Gene3D G3DSA:3.40.630.30 -
132 148 PRINTS PR01754 Streptothricin acetyltransferase signature
132 148 InterPro IPR008125 Streptothricin acetyltransferase
155 168 PRINTS PR01754 Streptothricin acetyltransferase signature
155 168 InterPro IPR008125 Streptothricin acetyltransferase
111 126 PRINTS PR01754 Streptothricin acetyltransferase signature
111 126 InterPro IPR008125 Streptothricin acetyltransferase
87 102 PRINTS PR01754 Streptothricin acetyltransferase signature
87 102 InterPro IPR008125 Streptothricin acetyltransferase
40 151 SUPERFAMILY SSF55729 Acyl-CoA N-acyltransferases (Nat)
40 151 InterPro IPR016181 Acyl-CoA N-acyltransferase
61 123 CDD cd04301 NAT_SF
64 141 PANTHER PTHR43877 -
45 140 Pfam PF00583 Acetyltransferase (GNAT) family
45 140 InterPro IPR000182 GNAT domain

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · FPocket

Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Site 1 FPocket #1
0.515
Likely same site as P2Rank 1 3.0 Å 30 shared residues 86% of smaller site
Unusual size
Show in viewer
Surrounding area

Binding pockets · P2Rank

Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Site 1 P2Rank #1
0.868
Likely same site as FPocket 1 3.0 Å 30 shared residues 86% of smaller site
Show in viewer
Surrounding area
Site 2 P2Rank #2
0.124
Show in viewer
Surrounding area
Site 3 P2Rank #3
0.008
Show in viewer
Surrounding area
Site 4 P2Rank #4
0.003
Show in viewer
Surrounding area
All structural evidence 0 experimental · 1 predicted

Structural evidence

0 + 1

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
ColabFold KP13_32246
ColabFold — — full sequence — Viewing

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

16 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 1 records from similar proteins
Structural ligands 1 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 15 similarity-based ZINC candidates
Best available ligand signal
TAR PDB via homolog 150.1 Da · LogP -2.12 · TPSA 115.1 Open detail RCSB PDB
ZINC12359024 ZINC proposed compound · Tanimoto 0.692 Detail ZINC
ZINC13533920 ZINC proposed compound · Tanimoto 0.692 Detail ZINC
ZINC1532740 ZINC proposed compound · Tanimoto 0.692 Detail ZINC
ZINC1549593 ZINC proposed compound · Tanimoto 0.692 Detail ZINC

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
TAR RCSB PDB
5C82
Q08414 150.1 Da LogP -2.12 TPSA 115.1 ✓ Ro5 ✓ Clean [C@H]([C@@H](C(=O)O)O)(C(=O)O)O

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.