KpKP13 Protein target profile

resolvase

Accession: KP13_32071

Gene: AHE47409.1 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0N8M6Y3
Length 245
Pocket druggability (P2Rank · AlphaFold DB model) 0.194
Functional annotation 0 EC 4 GO
Target summary

Target candidate with partial support; inspect missing evidence before prioritizing.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
0.1% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
0.0 Higher values support similarity to known essential genes.

Structure confidence

ColabFold pLDDT
83.84 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.194
Structure A0A0N8M6Y3
Pocket Pocket 1
Druggability (FPocket) 0.835
Structure A0A0N8M6Y3
Pocket Pocket 1
ColabFold model
P2Rank 0.033 · Pocket 1
FPocket 0.364 · Pocket 6
Core conservation Accessory gene
Roary accessory
CoreCruncher accessory
Gut microbiome 5 / 4744 genomes with a hit
Prevalence 0.1%

Sequence

Primary amino-acid sequence viewer.

MRRTKPVAAPMVARVYLRVSTDAQDLERQEAITTAAKAAGYYVAGIYREKASGARADRPELLRMIGDLQPGEVVIAEKIDRISRLPLPEAERLVASIQAKGASLAVPGVVDLSDLAAEAQGVAKIVLEAVQIMLFRLALQMARDDYEDRRERQRQGIELARQAGRYKGRRADPKRRAQVVALRKSGYSINKTAELAGYSAAQVKRIWAEVSQAEAKQHGAFVEDALTEADALAAVGQDERQEERA

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

4 GO

Subcellular localization

Localization
Cytoplasmic

Gene Ontology (GO)

4
  • GO:0000150 Catalysis of the identification and base-pairing of homologous sequences between single-stranded DNA and double-stranded DNA.
  • GO:0006310 Any process in which a new genotype is formed by reassortment of genes resulting in gene combinations different from those that were present in the parents. In eukaryotes genetic recombination can occur by chromosome assortment, intrachromosomal recombination, or nonreciprocal interchromosomal recombination. Interchromosomal recombination occurs by crossing over. In bacteria it may occur by genetic transformation, conjugation, transduction, or F-duction.
  • GO:0003677 Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
  • GO:0015074 The process in which a DNA segment is incorporated into another, usually larger, DNA molecule such as a chromosome.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

18 records
Show feature table
Start End DB Term Name
71 83 ProSitePatterns PS00398 Site-specific recombinases signature 2.
71 83 InterPro IPR006118 Recombinase, conserved site
15 166 Pfam PF00239 Resolvase, N terminal domain
15 166 InterPro IPR006119 Resolvase, N-terminal catalytic domain
12 156 ProSiteProfiles PS51736 Resolvase/invertase-type recombinase catalytic domain profile.
12 156 InterPro IPR006119 Resolvase, N-terminal catalytic domain
11 176 Gene3D G3DSA:3.40.50.1390 -
11 176 InterPro IPR036162 Resolvase-like, N-terminal catalytic domain superfamily
143 163 Coils Coil Coil
11 166 SUPERFAMILY SSF53041 Resolvase-like
11 166 InterPro IPR036162 Resolvase-like, N-terminal catalytic domain superfamily
13 166 SMART SM00857 resolvase_6
13 166 InterPro IPR006119 Resolvase, N-terminal catalytic domain
16 24 ProSitePatterns PS00397 Site-specific recombinases active site.
16 24 InterPro IPR006118 Recombinase, conserved site
173 209 Pfam PF02796 Helix-turn-helix domain of resolvase
173 209 InterPro IPR006120 Resolvase, HTH domain
15 171 PANTHER PTHR30461 DNA-INVERTASE FROM LAMBDOID PROPHAGE

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.194
Likely same site as FPocket 1 4.3 Å 10 shared residues 83% of smaller site
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.003
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.001
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #1
0.835
Likely same site as P2Rank 1 4.3 Å 10 shared residues 83% of smaller site
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0N8M6Y3
AlphaFold DB full sequence Viewing
ColabFold KP13_32071
ColabFold full sequence Loaded

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.