Genome KpKP13

Protein target profile

resolvase resD

Accession: KP13_32072

Gene: AHE47419.1 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A246R2I0
Export view
Length 246
Pocket druggability (P2Rank) 0.65
Functional annotation 0 EC 3 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Main supporting evidence

Independent pocket support: P2Rank + FPocket Both predictors report a high-scoring binding site (P2Rank 0.65, FPocket 0.98). Use the 3D pocket comparison to verify whether they identify the same site. No similar human protein detected The current BLAST sequence screen did not find a significant human match, lowering apparent off-target risk. Strong predicted binding pocket FPocket selected-pocket score 0.98. This is a computational pocket signal, not binding validation. Second pocket predictor agrees P2Rank predicted binding-site probability 0.65. Review the complete evidence below

Risks to review

Microbiome similarity 29 of 4744 screened genomes (0.6%) have a significant similarity hit. This target also has a predicted binding pocket (P2Rank 0.65) — check the ligand evidence before deprioritizing on off-target risk alone. Mixed conservation Core/accessory calls are not fully concordant.

Evidence gaps

No metabolic context No SBML/network-derived reaction evidence is loaded for this protein. No ligand evidence No experimental PDB ligands, measured ChEMBL bioactivity, or proposed ZINC compound records are available.
Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
0.6% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
0.0 Higher values support similarity to known essential genes.

Structure confidence

ColabFold pLDDT
82.26 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.65
Structure A0A246R2I0
Pocket Pocket 1
Druggability (FPocket) 0.982
Structure A0A246R2I0
Pocket Pocket 1
ColabFold model
P2Rank 0.413 · Pocket 1
FPocket 0.568 · Pocket 9
Core conservation Accessory gene
Roary accessory
CoreCruncher accessory
Gut microbiome 29 / 4744 genomes with a hit
Prevalence 0.6%

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Sequence

UniProt A0A246R2I0

Sequence

Primary amino-acid sequence viewer.

MNTFPLQISQNSRSDAIGTGRVTYAYFDYADALALREMASQADLPKYLLAPEVSVFLRYVPDLRQQVLFDTLWNTGARINEALALTGASFQLDGSRPFVRLKTLKQRQRGRGRPGKDEEVFRLVPLTDPQYVRKVREFLTTLRIGKQQLLWPVQSDNTPRNWIRKALDLAKRDSVTFSIPVTCHTFRHSFCMHLIQHGVPLKVVQAYAGHSRLETTETYTRVFALDVGRQYGVRFSLPDSHLTLPE

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

3 GO

Subcellular localization

Localization
Cytoplasmic

Gene Ontology (GO)

3
  • GO:0006310 Any process in which a new genotype is formed by reassortment of genes resulting in gene combinations different from those that were present in the parents. In eukaryotes genetic recombination can occur by chromosome assortment, intrachromosomal recombination, or nonreciprocal interchromosomal recombination. Interchromosomal recombination occurs by crossing over. In bacteria it may occur by genetic transformation, conjugation, transduction, or F-duction.
  • GO:0003677 Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
  • GO:0015074 The process in which a DNA segment is incorporated into another, usually larger, DNA molecule such as a chromosome.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

10 records
Show feature table
Start End DB Term Name
1 245 PIRSF PIRSF004576 Resolvase_Rsv
1 245 InterPro IPR016423 Resolvase, Rsv
40 232 Gene3D G3DSA:1.10.443.10 Intergrase catalytic core
40 232 InterPro IPR013762 Integrase-like, catalytic domain superfamily
47 224 SUPERFAMILY SSF56349 DNA breaking-rejoining enzymes
47 224 InterPro IPR011010 DNA breaking-rejoining enzyme, catalytic core
43 232 ProSiteProfiles PS51898 Tyrosine recombinase domain profile.
43 232 InterPro IPR002104 Integrase, catalytic domain
46 223 Pfam PF00589 Phage integrase family
46 223 InterPro IPR002104 Integrase, catalytic domain

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.65
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.226
Likely same site as FPocket 1 7.4 Å 6 shared residues 75% of smaller site
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #1
0.982 Unusual size
Likely same site as P2Rank 2 7.4 Å 6 shared residues 75% of smaller site
Show in viewer
Surrounding area
Pocket 2 FPocket #5
0.292
Show in viewer
Surrounding area
Pocket 3 FPocket #18
0.273
Show in viewer
Surrounding area
Pocket 4 FPocket #3
0.219
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A246R2I0
AlphaFold DB — — full sequence — Viewing
ColabFold KP13_32072
ColabFold — — full sequence — Loaded