Target candidate with partial support; inspect missing evidence before prioritizing.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- Hit
- Human identity (%)
- 53.968 Lower values reduce human off-target concern.
- Human E-value
- 5.84e-97
- Gut microbiome similarity
- 3.5% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- Y
- DEG identity (%)
- 58.759 Higher values support similarity to known essential genes.
- DEG E-value
- 3.32e-120 Smaller values mean stronger essential-gene similarity.
Structure confidence
- ColabFold pLDDT
- 98.28 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MERLEHHASFDGWQEVYQHESGTLGCTMKFGVYTPPQALNGNVPVLYWLSGLTCTEQNFITKSSVQRYAAEHGIMIVAPDTSPRGTDIPDDPDYALGQGAGFYVNATQEPWATHYKMYDYVVNELPSLIEEWFPASDKRSISGHSMGGHGALMIALRNPGRYQSVSAFSPIVAPSQVPWGENALSAYLGDDREYWKQYDTVELIRKAQERLPLLVDQGLNDEFLKTQLQPERLKSVCEDTGHPLTLNLRPGHDHSYYFISSYIGDHIAHHAAALTR
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- Unknown
Enzyme Commission (EC)
1Gene Ontology (GO)
4- GO:0018738 Catalysis of the reaction: S-formylglutathione + H2O = formate + glutathione + H+.
- GO:0046294 The chemical reactions and pathways resulting in the breakdown of formaldehyde (methanal, H2C=O), the simplest aldehyde.
- GO:0005829 The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
- GO:0052689 Catalysis of the hydrolysis of a carboxylic ester bond.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 21 | 266 | Pfam | PF00756 | Putative esterase |
| 21 | 266 | InterPro | IPR000801 | Esterase-like |
| 4 | 274 | NCBIfam | TIGR02821 | S-formylglutathione hydrolase |
| 4 | 274 | InterPro | IPR014186 | S-formylglutathione hydrolase |
| 1 | 274 | SUPERFAMILY | SSF53474 | alpha/beta-Hydrolases |
| 1 | 274 | InterPro | IPR029058 | Alpha/Beta hydrolase fold |
| 1 | 276 | FunFam | G3DSA:3.40.50.1820:FF:000002 | S-formylglutathione hydrolase |
| 2 | 275 | PANTHER | PTHR10061 | S-FORMYLGLUTATHIONE HYDROLASE |
| 2 | 275 | InterPro | IPR014186 | S-formylglutathione hydrolase |
| 1 | 275 | Gene3D | G3DSA:3.40.50.1820 | alpha/beta hydrolase |
| 1 | 275 | InterPro | IPR029058 | Alpha/Beta hydrolase fold |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A1J0QZX8
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
KP13_03954
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural and bioactivity evidence are both available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
| Ligand | UniProt (homolog) | pchembl | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| CHEMBL4635246 ChEMBL | P10768 | 9.10 ~0.8 nM | 349.8 Da LogP 4.80 TPSA 48.7 | ✓ Ro5 | Alert |
Oc1ccc(Cl)cc1C1=NN(c2ccccn2)C(c2ccccc2)C1
|
| CHEMBL157404 ChEMBL | Q9GJT2 | 7.89 ~12.9 nM | 762.2 Da LogP 1.79 TPSA 223.4 | 2 viol. | ✓ Clean |
COC(=O)/C(OC(C)=O)=C(\NC(=O)[C@@H]1CCCN1C(=O)[C…
|
| DWT ChEMBL | P10768 | 6.93 ~117.5 nM | 503.5 Da LogP 5.75 TPSA 97.6 | 2 viol. | ✓ Clean |
Cc1ccc(cc1Nc2c3cn(nc3nc(n2)c4cccnc4)C)C(=O)Nc5c…
|
| CHEMBL160446 ChEMBL | Q9GJT2 | 6.89 ~128.8 nM | 554.6 Da LogP -0.34 TPSA 186.5 | 1 viol. | ✓ Clean |
COC(=O)CCC(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N1C…
|
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC1644076 ZINC | 1.000 | 214.4 Da LogP 4.68 TPSA 20.2 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCCO
|
| ZINC1680803 ZINC | 1.000 | 200.4 Da LogP 4.29 TPSA 20.2 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCO
|
| ZINC72221860 ZINC | 0.706 | 207.2 Da LogP 2.51 TPSA 20.3 | ✓ Ro5 | ✓ Clean |
O=CN1CCCC[C@H]1c1ccc(F)cc1
|
| ZINC72221861 ZINC | 0.706 | 207.2 Da LogP 2.51 TPSA 20.3 | ✓ Ro5 | ✓ Clean |
O=CN1CCCC[C@@H]1c1ccc(F)cc1
|
| ZINC2149802 ZINC | 0.684 | 210.4 Da LogP 3.90 TPSA 20.2 | ✓ Ro5 | ✓ Clean |
CCCCCCC#CCCCCCCO
|
| ZINC2555300 ZINC | 0.684 | 238.4 Da LogP 4.68 TPSA 20.2 | ✓ Ro5 | ✓ Clean |
CCCCCCC#CCCCCCCCCO
|
| ZINC2579260 ZINC | 0.684 | 238.4 Da LogP 4.68 TPSA 20.2 | ✓ Ro5 | ✓ Clean |
CCCCCCCCC#CCCCCCCO
|
| ZINC59724910 ZINC | 0.684 | 212.4 Da LogP 4.46 TPSA 20.2 | ✓ Ro5 | ✓ Clean |
CCCCCCCC/C=C/CCCCO
|
| ZINC59724924 ZINC | 0.684 | 212.4 Da LogP 4.46 TPSA 20.2 | ✓ Ro5 | ✓ Clean |
CCCCCCCC/C=C\CCCCO
|
| ZINC59724927 ZINC | 0.684 | 212.4 Da LogP 4.46 TPSA 20.2 | ✓ Ro5 | ✓ Clean |
CCCCCC/C=C\CCCCCCO
|
| ZINC95831576 ZINC | 0.684 | 230.4 Da LogP 3.92 TPSA 29.5 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCOCCCCO
|
| ZINC72221525 ZINC | 0.649 | 219.3 Da LogP 2.38 TPSA 29.5 | ✓ Ro5 | ✓ Clean |
COc1ccc([C@@H]2CCCCN2C=O)cc1
|
| ZINC72221526 ZINC | 0.649 | 219.3 Da LogP 2.38 TPSA 29.5 | ✓ Ro5 | ✓ Clean |
COc1ccc([C@H]2CCCCN2C=O)cc1
|
| ZINC15721440 ZINC | 0.636 | 470.5 Da LogP -0.83 TPSA 171.2 | ✓ Ro5 | ✓ Clean |
COC(=O)CCC(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N1C…
|
| ZINC2080120662 ZINC | 0.632 | 234.3 Da LogP 2.28 TPSA 63.5 | ✓ Ro5 | ✓ Clean |
O=CN1CCCC[C@@H]1c1ccc([N+](=O)[O-])cc1
|
| ZINC2080120663 ZINC | 0.632 | 234.3 Da LogP 2.28 TPSA 63.5 | ✓ Ro5 | ✓ Clean |
O=CN1CCCC[C@H]1c1ccc([N+](=O)[O-])cc1
|
| ZINC100244447 ZINC | 0.619 | 276.5 Da LogP 4.04 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCC[S@@](=O)CCCCCCCO
|
| ZINC100244449 ZINC | 0.619 | 276.5 Da LogP 4.04 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCC[S@](=O)CCCCCCCO
|
| ZINC98008412 ZINC | 0.619 | 250.4 Da LogP 2.53 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCCS(=O)(=O)CCCCO
|
| ZINC98008413 ZINC | 0.619 | 234.4 Da LogP 2.87 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCC[S@@](=O)CCCCO
|
| ZINC98008414 ZINC | 0.619 | 234.4 Da LogP 2.87 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCC[S@](=O)CCCCO
|
| ZINC14771652 ZINC | 0.615 | 216.4 Da LogP 3.26 TPSA 40.5 | ✓ Ro5 | ✓ Clean |
OCCCCCCCCCCCCCO
|
| ZINC15269439 ZINC | 0.615 | 272.5 Da LogP 4.82 TPSA 40.5 | ✓ Ro5 | ✓ Clean |
OCCCCCCCCCCCCCCCCCO
|
| ZINC1574339 ZINC | 0.615 | 202.3 Da LogP 2.87 TPSA 40.5 | ✓ Ro5 | ✓ Clean |
OCCCCCCCCCCCCO
|
| ZINC4202510 ZINC | 0.615 | 230.4 Da LogP 3.65 TPSA 40.5 | ✓ Ro5 | ✓ Clean |
OCCCCCCCCCCCCCCO
|
| ZINC4521552 ZINC | 0.615 | 258.4 Da LogP 4.43 TPSA 40.5 | ✓ Ro5 | ✓ Clean |
OCCCCCCCCCCCCCCCCO
|
| ZINC4600152 ZINC | 0.615 | 244.4 Da LogP 4.04 TPSA 40.5 | ✓ Ro5 | ✓ Clean |
OCCCCCCCCCCCCCCCO
|
| ZINC72217633 ZINC | 0.605 | 298.4 Da LogP 3.92 TPSA 33.2 | ✓ Ro5 | ✓ Clean |
O=CN1CCCC[C@H]1c1ccc(Sc2ccccc2)nc1
|
| ZINC72217634 ZINC | 0.605 | 298.4 Da LogP 3.92 TPSA 33.2 | ✓ Ro5 | ✓ Clean |
O=CN1CCCC[C@@H]1c1ccc(Sc2ccccc2)nc1
|
| ZINC100245871 ZINC | 0.600 | 232.4 Da LogP 4.24 TPSA 20.2 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCSCCCO
|
| ZINC1682375 ZINC | 0.600 | 215.4 Da LogP 3.05 TPSA 23.5 | ✓ Ro5 | ✓ Clean |
CCCCN(CCCC)CCCCCO
|
| ZINC2009358 ZINC | 0.600 | 212.4 Da LogP 4.46 TPSA 20.2 | ✓ Ro5 | ✓ Clean |
CCCC/C=C/CCCCCCCCO
|
| ZINC2555306 ZINC | 0.600 | 238.4 Da LogP 4.68 TPSA 20.2 | ✓ Ro5 | ✓ Clean |
CCCCC#CCCCCCCCCCCO
|
| ZINC2555345 ZINC | 0.600 | 210.4 Da LogP 3.90 TPSA 20.2 | ✓ Ro5 | ✓ Clean |
CCCCC#CCCCCCCCCO
|
| ZINC4409966 ZINC | 0.600 | 257.5 Da LogP 4.22 TPSA 23.5 | ✓ Ro5 | ✓ Clean |
CCCCN(CCCC)CCCCCCCCO
|
| ZINC4409972 ZINC | 0.600 | 271.5 Da LogP 4.61 TPSA 23.5 | ✓ Ro5 | ✓ Clean |
CCCCN(CCCC)CCCCCCCCCO
|
| ZINC4528894 ZINC | 0.600 | 212.4 Da LogP 4.46 TPSA 20.2 | ✓ Ro5 | ✓ Clean |
CCCC/C=C\CCCCCCCCO
|
| ZINC545509 ZINC | 0.600 | 314.8 Da LogP 3.74 TPSA 52.9 | ✓ Ro5 | Alert |
CC(=O)N1N=C(c2cc(Cl)ccc2O)C[C@@H]1c1ccccc1
|
| ZINC545510 ZINC | 0.600 | 314.8 Da LogP 3.74 TPSA 52.9 | ✓ Ro5 | Alert |
CC(=O)N1N=C(c2cc(Cl)ccc2O)C[C@H]1c1ccccc1
|
| ZINC59545536 ZINC | 0.600 | 258.4 Da LogP 4.70 TPSA 29.5 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCOCCCO
|
| ZINC72219597 ZINC | 0.595 | 240.3 Da LogP 2.92 TPSA 33.2 | ✓ Ro5 | ✓ Clean |
O=CN1CCCC[C@H]1c1cnc2ccccc2c1
|
| ZINC72219598 ZINC | 0.595 | 240.3 Da LogP 2.92 TPSA 33.2 | ✓ Ro5 | ✓ Clean |
O=CN1CCCC[C@@H]1c1cnc2ccccc2c1
|
| ZINC104156515 ZINC | 0.591 | 283.5 Da LogP 4.80 TPSA 42.2 | ✓ Ro5 | ✓ Clean |
CCCCCCCC[C@H]1N[C@H]1CCCCCCCCO
|
| ZINC104156519 ZINC | 0.591 | 283.5 Da LogP 4.80 TPSA 42.2 | ✓ Ro5 | ✓ Clean |
CCCCCCCC[C@@H]1N[C@H]1CCCCCCCCO
|
| ZINC104156523 ZINC | 0.591 | 283.5 Da LogP 4.80 TPSA 42.2 | ✓ Ro5 | ✓ Clean |
CCCCCCCC[C@H]1N[C@@H]1CCCCCCCCO
|
| ZINC104156528 ZINC | 0.591 | 283.5 Da LogP 4.80 TPSA 42.2 | ✓ Ro5 | ✓ Clean |
CCCCCCCC[C@@H]1N[C@@H]1CCCCCCCCO
|
| ZINC72212171 ZINC | 0.591 | 282.3 Da LogP 3.56 TPSA 42.4 | ✓ Ro5 | ✓ Clean |
O=CN1CCCC[C@H]1c1ccc(Oc2ccccc2)nc1
|
| ZINC72212172 ZINC | 0.591 | 282.3 Da LogP 3.56 TPSA 42.4 | ✓ Ro5 | ✓ Clean |
O=CN1CCCC[C@@H]1c1ccc(Oc2ccccc2)nc1
|
| ZINC72214110 ZINC | 0.591 | 281.4 Da LogP 3.51 TPSA 45.2 | ✓ Ro5 | ✓ Clean |
O=CN1CCCC[C@H]1c1ccc(Nc2ccccc2)nc1
|
| ZINC72214111 ZINC | 0.591 | 281.4 Da LogP 3.51 TPSA 45.2 | ✓ Ro5 | ✓ Clean |
O=CN1CCCC[C@@H]1c1ccc(Nc2ccccc2)nc1
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.