Overview
Basic information about this protein and its source genome.
- Accession
- PA1574
- Gene
- ppnP PA1574
- Status
- annotated
- Amino acids
- 93
- Structure source
- Experimental + AlphaFold
Target profile
Computed evidence for target prioritization.
- Human off-target
- No hit
- Gut microbiome off-target
- hit
- Essential (DEG)
- Y
- Localization
- Unknown
Selected Druggability evidence
Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MFKVNEYFDGTVKSIAFDMTAGPATIGVMAAGEYEFGTSQLEIMHVVAGALTVKLPGSDEWQEYASGSQFTVPANSKFQLKVAQDTAYLCEYR
Functional Annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Gene Ontology (GO)
6- GO:0005829 The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
- GO:0047975 Catalysis of the reaction: guanosine + phosphate = alpha-D-ribose 1-phosphate + guanine.
- GO:0004731 Catalysis of the reaction: purine nucleoside + phosphate = purine + alpha-D-ribose 1-phosphate.
- GO:0016154 Catalysis of the reaction: pyrimidine nucleoside + phosphate = pyrimidine + alpha-D-ribose 1-phosphate.
- GO:0009032 Catalysis of the reaction: thymidine + phosphate = thymine + 2-deoxy-D-ribose 1-phosphate.
- GO:0004850 Catalysis of the reaction: uridine + phosphate = uracil + alpha-D-ribose 1-phosphate.
Sequence Features
Domain/signature hits from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 4 | 92 | CDD | cd20296 | cupin_PpnP-like |
| 1 | 93 | Hamap | MF_01537 | Pyrimidine/purine nucleoside phosphorylase [ppnP]. |
| 1 | 93 | InterPro | IPR009664 | Pyrimidine/purine nucleoside phosphorylase |
| 3 | 92 | Pfam | PF06865 | Pyrimidine/purine nucleoside phosphorylase |
| 3 | 92 | InterPro | IPR009664 | Pyrimidine/purine nucleoside phosphorylase |
| 2 | 92 | PANTHER | PTHR36540 | PYRIMIDINE/PURINE NUCLEOSIDE PHOSPHORYLASE |
| 2 | 92 | InterPro | IPR009664 | Pyrimidine/purine nucleoside phosphorylase |
| 1 | 93 | FunFam | G3DSA:2.60.120.10:FF:000016 | Pyrimidine/purine nucleoside phosphorylase |
| 1 | 92 | SUPERFAMILY | SSF51182 | RmlC-like cupins |
| 1 | 92 | InterPro | IPR011051 | RmlC-like cupin domain superfamily |
| 1 | 93 | Gene3D | G3DSA:2.60.120.10 | Jelly Rolls |
| 1 | 93 | InterPro | IPR014710 | RmlC-like jelly roll fold |
3D Structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.
Loading 3D structure...
Structural evidence
1 + 1Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 1 | 0.661 | ||||||
| 2 | 0.28 |
Pockets (P2RANK)
Showing top-ranked P2Rank candidates by probability. Probability is color-coded per P2Rank calibration: high (≥ 0.5), medium (0.2 – 0.49), low (< 0.2).
| P2RANK | Sticks | Spheres | Surfaces | Score | Probability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|---|
| 1 | 13.47 | 0.688 |
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 1 | 0.911 | ||||||
| 2 | 0.41 |