KpATCC43816 Protein target profile

ribonucleoside-diphosphate reductase subunit beta nrdF2

Accession: VK055_4510

Gene: AIK83048.1 nrdF2 3D evidence: AlphaFold DB model + ColabFold model Metabolism 8 reactions UniProt A0A0H3GU80
Length 320
Pocket druggability (P2Rank · AlphaFold DB model) 0.115
Metabolic reactions 8
Chokepoint No
Direct ligand evidence 0 60 total records
Functional annotation 1 EC 5 GO
Target summary

Target candidate with partial support; inspect missing evidence before prioritizing.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
Hit
Human identity (%)
22.0 Lower values reduce human off-target concern.
Human E-value
5.93e-07
Gut microbiome similarity
6.2% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
71.924 Higher values support similarity to known essential genes.
DEG E-value
4.29e-174 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
91.67 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.115
Structure A0A0H3GU80
Pocket Pocket 1
Druggability (FPocket) 0.548
Structure A0A0H3GU80
Pocket Pocket 1
ColabFold model
P2Rank 0.188 · Pocket 1
FPocket 0.68 · Pocket 11
Core conservation Accessory gene
Roary core
CoreCruncher accessory
Gut microbiome 292 / 4744 genomes with a hit
Prevalence 6.2%

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

Explore metabolic network

Metabolic context: more central than 97.7% of genes in this genome.

Relative network centrality 97.7% more central than 97.7% of genes in this genome
Chokepoint Not a chokepoint
Catalyzed reactions

8 reactions mapped to this gene in the metabolic model. Open the full network to see each one, with substrates/products and the reaction-reaction map.

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MTHLTRVSAINWNRIDDDKDLEVWNRLTSNFWLPEKVPLSNDIPAWQTLSAAEQQLTIRVFTGLTLLDTIQNTVGAPALMADALTPHEEAVLSNISFMEAVHARSYSSIFSTLCHSKEVDAAFAWSESCDPLQRKAQLMLGYYQADEPLKKKIASVFLESFLFYSGFWLPMYFSSRGKLTNTADLIRLIIRDEAVHGYYIGYKYQKGLEIVSPGKREELKNFALDLLMDLYDNELAYSRELYGESGWFDDVSAFLCYNANKALMNLGYEALFPAEMAAVNPAILAALSPNADENHDFFSGSGSSYVIGKMEETADDDWDF

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 5 GO

Subcellular localization

Localization
Cytoplasmic

Enzyme Commission (EC)

1

Gene Ontology (GO)

5
  • GO:0005971 An enzyme complex composed of 2-4 or more subunits, which usually contains nonheme iron and requires ATP for catalysis. Catalyzes the formation of 2'-deoxyribonucleoside diphosphate from ribonucleoside diphosphate, using either thioredoxin disulfide or glutaredoxin disulfide as an acceptor.
  • GO:0009263 The chemical reactions and pathways resulting in the formation of a deoxyribonucleotide, a compound consisting of deoxyribonucleoside (a base linked to a deoxyribose sugar) esterified with a phosphate group at either the 3' or 5'-hydroxyl group of the sugar.
  • GO:0016491 Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
  • GO:0046872 Binding to a metal ion.
  • GO:0004748 Catalysis of the reaction: 2'-deoxyribonucleoside diphosphate + thioredoxin disulfide + H2O = ribonucleoside diphosphate + thioredoxin. Thioredoxin disulfide is the oxidized form of thioredoxin.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

16 records
Show feature table
Start End DB Term Name
10 281 CDD cd01049 RNRR2
10 281 InterPro IPR033909 Ribonucleotide reductase small subunit
1 317 PIRSF PIRSF000355 NrdB
1 317 InterPro IPR000358 Ribonucleotide reductase small subunit family
7 320 SUPERFAMILY SSF47240 Ferritin-like
7 320 InterPro IPR009078 Ferritin-like superfamily
9 309 PANTHER PTHR23409 RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE SMALL CHAIN
9 309 InterPro IPR000358 Ribonucleotide reductase small subunit family
10 281 Pfam PF00268 Ribonucleotide reductase, small chain
10 281 InterPro IPR000358 Ribonucleotide reductase small subunit family
1 292 Gene3D G3DSA:1.10.620.20 Ribonucleotide Reductase, subunit A
1 292 InterPro IPR012348 Ribonucleotide reductase-like
8 320 NCBIfam TIGR04171 class 1b ribonucleoside-diphosphate reductase subunit beta
8 320 InterPro IPR026494 Ribonucleoside-diphosphate reductase subunit beta
98 114 ProSitePatterns PS00368 Ribonucleotide reductase small subunit signature.
98 114 InterPro IPR030475 Ribonucleotide reductase small subunit, acitve site

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.115
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.084
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.005
Show in viewer
Surrounding area
Pocket 4 P2Rank #4
0.002
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #1
0.548
Show in viewer
Surrounding area
Residue sets
UniProt: Active site:106-106
UniProt: Binding site:102-102
UniProt: Binding site:159-159
UniProt: Binding site:193-193
UniProt: Binding site:196-196
UniProt: Binding site:68-68
UniProt: Binding site:99-99
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GU80
AlphaFold DB full sequence Viewing
ColabFold VK055_4510
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

60 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 10 records from similar proteins
Structural ligands 10 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
AZI PDB via homolog 42.0 Da · LogP 0.87 · TPSA 58.7 Open detail RCSB PDB
BTB PDB via homolog Detail RCSB PDB
DAT PDB via homolog Detail RCSB PDB
DGT PDB via homolog Detail RCSB PDB
DTP PDB via homolog Detail RCSB PDB

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
AZI RCSB PDB P69924 42.0 Da LogP 0.87 TPSA 58.7 ✓ Ro5 Alert [N-]=[N+]=[N-]
BTB RCSB PDB Q81TB4 209.2 Da LogP -3.01 TPSA 104.4 ✓ Ro5 ✓ Clean C(CO)N(CCO)C(CO)(CO)CO
DAT RCSB PDB P69924 411.2 Da LogP -0.72 TPSA 212.4 1 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3C[C@@H]([C@H](O3)CO[P@]…
DGT RCSB PDB P69924 507.2 Da LogP -1.31 TPSA 278.9 3 viol. ✓ Clean c1nc2c(n1[C@H]3C[C@@H]([C@H](O3)CO[P@@](=O)(O)O…
DTP RCSB PDB P69924 491.2 Da LogP -0.60 TPSA 258.9 2 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3C[C@@H]([C@H](O3)CO[P@]…
FEO RCSB PDB P17424 127.7 Da LogP -0.07 TPSA 9.2 ✓ Ro5 ✓ Clean O([Fe])[Fe]
O RCSB PDB P69924 18.0 Da LogP -0.82 TPSA 31.5 ✓ Ro5 ✓ Clean O
OXY RCSB PDB O69274 32.0 Da LogP 0.07 TPSA 34.1 ✓ Ro5 ✓ Clean O=O
PEO RCSB PDB P37146 34.0 Da LogP 0.02 TPSA 40.5 ✓ Ro5 ✓ Clean OO
TTP RCSB PDB P69924 482.2 Da LogP -1.16 TPSA 244.1 2 viol. ✓ Clean CC1=CN(C(=O)NC1=O)[C@H]2C[C@@H]([C@H](O2)CO[P@]…

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.