KpATCC43816 Protein target profile
ribonucleoside-diphosphate reductase subunit beta nrdF2
Accession: VK055_4510
Target candidate with partial support; inspect missing evidence before prioritizing.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Evidence coverage
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- Hit
- Human identity (%)
- 22.0 Lower values reduce human off-target concern.
- Human E-value
- 5.93e-07
- Gut microbiome similarity
- 6.2% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- Y
- DEG identity (%)
- 71.924 Higher values support similarity to known essential genes.
- DEG E-value
- 4.29e-174 Smaller values mean stronger essential-gene similarity.
Structure confidence
- ColabFold pLDDT
- 91.67 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MTHLTRVSAINWNRIDDDKDLEVWNRLTSNFWLPEKVPLSNDIPAWQTLSAAEQQLTIRVFTGLTLLDTIQNTVGAPALMADALTPHEEAVLSNISFMEAVHARSYSSIFSTLCHSKEVDAAFAWSESCDPLQRKAQLMLGYYQADEPLKKKIASVFLESFLFYSGFWLPMYFSSRGKLTNTADLIRLIIRDEAVHGYYIGYKYQKGLEIVSPGKREELKNFALDLLMDLYDNELAYSRELYGESGWFDDVSAFLCYNANKALMNLGYEALFPAEMAAVNPAILAALSPNADENHDFFSGSGSSYVIGKMEETADDDWDF
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- Cytoplasmic
Enzyme Commission (EC)
1Gene Ontology (GO)
5- GO:0005971 An enzyme complex composed of 2-4 or more subunits, which usually contains nonheme iron and requires ATP for catalysis. Catalyzes the formation of 2'-deoxyribonucleoside diphosphate from ribonucleoside diphosphate, using either thioredoxin disulfide or glutaredoxin disulfide as an acceptor.
- GO:0009263 The chemical reactions and pathways resulting in the formation of a deoxyribonucleotide, a compound consisting of deoxyribonucleoside (a base linked to a deoxyribose sugar) esterified with a phosphate group at either the 3' or 5'-hydroxyl group of the sugar.
- GO:0016491 Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
- GO:0046872 Binding to a metal ion.
- GO:0004748 Catalysis of the reaction: 2'-deoxyribonucleoside diphosphate + thioredoxin disulfide + H2O = ribonucleoside diphosphate + thioredoxin. Thioredoxin disulfide is the oxidized form of thioredoxin.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 10 | 281 | CDD | cd01049 | RNRR2 |
| 10 | 281 | InterPro | IPR033909 | Ribonucleotide reductase small subunit |
| 1 | 317 | PIRSF | PIRSF000355 | NrdB |
| 1 | 317 | InterPro | IPR000358 | Ribonucleotide reductase small subunit family |
| 7 | 320 | SUPERFAMILY | SSF47240 | Ferritin-like |
| 7 | 320 | InterPro | IPR009078 | Ferritin-like superfamily |
| 9 | 309 | PANTHER | PTHR23409 | RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE SMALL CHAIN |
| 9 | 309 | InterPro | IPR000358 | Ribonucleotide reductase small subunit family |
| 10 | 281 | Pfam | PF00268 | Ribonucleotide reductase, small chain |
| 10 | 281 | InterPro | IPR000358 | Ribonucleotide reductase small subunit family |
| 1 | 292 | Gene3D | G3DSA:1.10.620.20 | Ribonucleotide Reductase, subunit A |
| 1 | 292 | InterPro | IPR012348 | Ribonucleotide reductase-like |
| 8 | 320 | NCBIfam | TIGR04171 | class 1b ribonucleoside-diphosphate reductase subunit beta |
| 8 | 320 | InterPro | IPR026494 | Ribonucleoside-diphosphate reductase subunit beta |
| 98 | 114 | ProSitePatterns | PS00368 | Ribonucleotide reductase small subunit signature. |
| 98 | 114 | InterPro | IPR030475 | Ribonucleotide reductase small subunit, acitve site |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Residue sets
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Residue sets
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GU80
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
VK055_4510
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural ligand evidence is available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| AZI RCSB PDB | P69924 | 42.0 Da LogP 0.87 TPSA 58.7 | ✓ Ro5 | Alert |
[N-]=[N+]=[N-]
|
|
| BTB RCSB PDB | Q81TB4 | 209.2 Da LogP -3.01 TPSA 104.4 | ✓ Ro5 | ✓ Clean |
C(CO)N(CCO)C(CO)(CO)CO
|
|
| DAT RCSB PDB | P69924 | 411.2 Da LogP -0.72 TPSA 212.4 | 1 viol. | ✓ Clean |
c1nc(c2c(n1)n(cn2)[C@H]3C[C@@H]([C@H](O3)CO[P@]…
|
|
| DGT RCSB PDB | P69924 | 507.2 Da LogP -1.31 TPSA 278.9 | 3 viol. | ✓ Clean |
c1nc2c(n1[C@H]3C[C@@H]([C@H](O3)CO[P@@](=O)(O)O…
|
|
| DTP RCSB PDB | P69924 | 491.2 Da LogP -0.60 TPSA 258.9 | 2 viol. | ✓ Clean |
c1nc(c2c(n1)n(cn2)[C@H]3C[C@@H]([C@H](O3)CO[P@]…
|
|
| FEO RCSB PDB | P17424 | 127.7 Da LogP -0.07 TPSA 9.2 | ✓ Ro5 | ✓ Clean |
O([Fe])[Fe]
|
|
| O RCSB PDB | P69924 | 18.0 Da LogP -0.82 TPSA 31.5 | ✓ Ro5 | ✓ Clean |
O
|
|
| OXY RCSB PDB | O69274 | 32.0 Da LogP 0.07 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
O=O
|
|
| PEO RCSB PDB | P37146 | 34.0 Da LogP 0.02 TPSA 40.5 | ✓ Ro5 | ✓ Clean |
OO
|
|
| TTP RCSB PDB | P69924 | 482.2 Da LogP -1.16 TPSA 244.1 | 2 viol. | ✓ Clean |
CC1=CN(C(=O)NC1=O)[C@H]2C[C@@H]([C@H](O2)CO[P@]…
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC12495199 ZINC | 1.000 | 411.2 Da LogP -0.72 TPSA 212.4 | 1 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1C[C@H](O)[C@@H](CO[P@@](=O…
|
| ZINC13434873 ZINC | 1.000 | 411.2 Da LogP -0.72 TPSA 212.4 | 1 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1C[C@H](O)[C@H](CO[P@@](=O)…
|
| ZINC13434875 ZINC | 1.000 | 411.2 Da LogP -0.72 TPSA 212.4 | 1 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1C[C@H](O)[C@H](CO[P@@](=O)(…
|
| ZINC13434876 ZINC | 1.000 | 411.2 Da LogP -0.72 TPSA 212.4 | 1 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1C[C@@H](O)[C@H](CO[P@](=O)…
|
| ZINC13434878 ZINC | 1.000 | 411.2 Da LogP -0.72 TPSA 212.4 | 1 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1C[C@@H](O)[C@H](CO[P@@](=O)…
|
| ZINC13507072 ZINC | 1.000 | 482.2 Da LogP -1.16 TPSA 244.1 | 2 viol. | ✓ Clean |
Cc1cn([C@@H]2C[C@@H](O)[C@H](CO[P@@](=O)(O)O[P@…
|
| ZINC1615342 ZINC | 1.000 | 209.2 Da LogP -3.01 TPSA 104.4 | ✓ Ro5 | ✓ Clean |
OCCN(CCO)C(CO)(CO)CO
|
| ZINC33979251 ZINC | 1.000 | 482.2 Da LogP -1.16 TPSA 244.1 | 2 viol. | ✓ Clean |
Cc1cn([C@@H]2C[C@H](O)[C@H](CO[P@@](=O)(O)O[P@@…
|
| ZINC8215728 ZINC | 1.000 | 411.2 Da LogP -0.72 TPSA 212.4 | 1 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1C[C@H](O)[C@@H](CO[P@@](=O)…
|
| ZINC12503703 ZINC | 0.982 | 427.2 Da LogP -1.42 TPSA 232.3 | 2 viol. | ✓ Clean |
Nc1nc2c(ncn2[C@@H]2C[C@H](O)[C@@H](CO[P@@](=O)(…
|
| ZINC8215878 ZINC | 0.982 | 427.2 Da LogP -1.42 TPSA 232.3 | 2 viol. | ✓ Clean |
Nc1nc2c(ncn2[C@H]2C[C@H](O)[C@@H](CO[P@@](=O)(O…
|
| ZINC13434879 ZINC | 0.981 | 491.2 Da LogP -0.60 TPSA 258.9 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1C[C@H](O)[C@H](CO[P@@](=O)…
|
| ZINC13434881 ZINC | 0.981 | 491.2 Da LogP -0.60 TPSA 258.9 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1C[C@H](O)[C@H](CO[P@@](=O)(…
|
| ZINC13434883 ZINC | 0.981 | 491.2 Da LogP -0.60 TPSA 258.9 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1C[C@@H](O)[C@H](CO[P@@](=O…
|
| ZINC13434884 ZINC | 0.981 | 491.2 Da LogP -0.60 TPSA 258.9 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1C[C@@H](O)[C@H](CO[P@@](=O)…
|
| ZINC8215662 ZINC | 0.981 | 491.2 Da LogP -0.60 TPSA 258.9 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1C[C@H](O)[C@@H](CO[P@@](=O)…
|
| ZINC8664605 ZINC | 0.981 | 491.2 Da LogP -0.60 TPSA 258.9 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1C[C@H](O)[C@@H](CO[P@@](=O…
|
| ZINC12503053 ZINC | 0.959 | 402.2 Da LogP -1.28 TPSA 197.6 | ✓ Ro5 | ✓ Clean |
Cc1cn([C@@H]2C[C@H](O)[C@@H](CO[P@@](=O)(O)OP(=…
|
| ZINC33979243 ZINC | 0.959 | 402.2 Da LogP -1.28 TPSA 197.6 | ✓ Ro5 | ✓ Clean |
Cc1cn([C@@H]2C[C@H](O)[C@H](CO[P@@](=O)(O)OP(=O…
|
| ZINC33979244 ZINC | 0.959 | 402.2 Da LogP -1.28 TPSA 197.6 | ✓ Ro5 | ✓ Clean |
Cc1cn([C@H]2C[C@H](O)[C@H](CO[P@@](=O)(O)OP(=O)…
|
| ZINC33979245 ZINC | 0.959 | 402.2 Da LogP -1.28 TPSA 197.6 | ✓ Ro5 | ✓ Clean |
Cc1cn([C@@H]2C[C@@H](O)[C@H](CO[P@@](=O)(O)OP(=…
|
| ZINC33979246 ZINC | 0.959 | 402.2 Da LogP -1.28 TPSA 197.6 | ✓ Ro5 | ✓ Clean |
Cc1cn([C@H]2C[C@@H](O)[C@H](CO[P@@](=O)(O)OP(=O…
|
| ZINC8215882 ZINC | 0.959 | 402.2 Da LogP -1.28 TPSA 197.6 | ✓ Ro5 | ✓ Clean |
Cc1cn([C@H]2C[C@H](O)[C@@H](CO[P@@](=O)(O)OP(=O…
|
| ZINC12958401 ZINC | 0.849 | 331.2 Da LogP -0.83 TPSA 165.8 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1C[C@@H](O)[C@@H](COP(=O)(O)…
|
| ZINC13538980 ZINC | 0.849 | 331.2 Da LogP -0.83 TPSA 165.8 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1C[C@@H](O)[C@@H](COP(=O)(O…
|
| ZINC13538982 ZINC | 0.849 | 331.2 Da LogP -0.83 TPSA 165.8 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1C[C@H](O)[C@@H](COP(=O)(O)…
|
| ZINC1532626 ZINC | 0.849 | 331.2 Da LogP -0.83 TPSA 165.8 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1C[C@@H](O)[C@H](COP(=O)(O)…
|
| ZINC1713574 ZINC | 0.849 | 331.2 Da LogP -0.83 TPSA 165.8 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1C[C@H](O)[C@@H](COP(=O)(O)O…
|
| ZINC3869813 ZINC | 0.849 | 331.2 Da LogP -0.83 TPSA 165.8 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1C[C@H](O)[C@H](COP(=O)(O)O…
|
| ZINC3869814 ZINC | 0.849 | 331.2 Da LogP -0.83 TPSA 165.8 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1C[C@H](O)[C@H](COP(=O)(O)O)…
|
| ZINC3869815 ZINC | 0.849 | 331.2 Da LogP -0.83 TPSA 165.8 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1C[C@@H](O)[C@H](COP(=O)(O)O…
|
| ZINC12296728 ZINC | 0.845 | 347.2 Da LogP -1.54 TPSA 185.8 | ✓ Ro5 | ✓ Clean |
Nc1nc2c(ncn2[C@H]2C[C@@H](O)[C@@H](COP(=O)(O)O)…
|
| ZINC13527599 ZINC | 0.845 | 347.2 Da LogP -1.54 TPSA 185.8 | ✓ Ro5 | ✓ Clean |
Nc1nc2c(ncn2[C@@H]2C[C@@H](O)[C@@H](COP(=O)(O)O…
|
| ZINC13527603 ZINC | 0.845 | 347.2 Da LogP -1.54 TPSA 185.8 | ✓ Ro5 | ✓ Clean |
Nc1nc2c(ncn2[C@@H]2C[C@H](O)[C@@H](COP(=O)(O)O)…
|
| ZINC1532627 ZINC | 0.845 | 347.2 Da LogP -1.54 TPSA 185.8 | ✓ Ro5 | ✓ Clean |
Nc1nc2c(ncn2[C@@H]2C[C@@H](O)[C@H](COP(=O)(O)O)…
|
| ZINC1730395 ZINC | 0.845 | 347.2 Da LogP -1.54 TPSA 185.8 | ✓ Ro5 | ✓ Clean |
Nc1nc2c(ncn2[C@H]2C[C@H](O)[C@@H](COP(=O)(O)O)O…
|
| ZINC3869846 ZINC | 0.845 | 347.2 Da LogP -1.54 TPSA 185.8 | ✓ Ro5 | ✓ Clean |
Nc1nc2c(ncn2[C@@H]2C[C@H](O)[C@H](COP(=O)(O)O)O…
|
| ZINC3869847 ZINC | 0.845 | 347.2 Da LogP -1.54 TPSA 185.8 | ✓ Ro5 | ✓ Clean |
Nc1nc2c(ncn2[C@H]2C[C@H](O)[C@H](COP(=O)(O)O)O2…
|
| ZINC3869848 ZINC | 0.845 | 347.2 Da LogP -1.54 TPSA 185.8 | ✓ Ro5 | ✓ Clean |
Nc1nc2c(ncn2[C@H]2C[C@@H](O)[C@H](COP(=O)(O)O)O…
|
| ZINC111459735 ZINC | 0.836 | 481.2 Da LogP -1.20 TPSA 249.9 | 2 viol. | ✓ Clean |
Cc1cn([C@@H]2C[C@H](N)[C@H](CO[P@@](=O)(O)O[P@@…
|
| ZINC138164075 ZINC | 0.836 | 498.2 Da LogP 0.21 TPSA 227.1 | 2 viol. | ✓ Clean |
Cc1cn([C@@H]2C[C@H](O)[C@H](CO[P@@](=O)(O)O[P@@…
|
| ZINC196576711 ZINC | 0.825 | 490.2 Da LogP -0.63 TPSA 264.7 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1C[C@H](N)[C@H](CO[P@@](=O)…
|
| ZINC142512519 ZINC | 0.818 | 498.2 Da LogP 0.21 TPSA 227.1 | 2 viol. | ✓ Clean |
Cc1cn([C@@H]2C[C@H](O)[C@H](CO[P@@](=O)(O)O[P@@…
|
| ZINC13523519 ZINC | 0.804 | 322.2 Da LogP -1.40 TPSA 151.1 | ✓ Ro5 | ✓ Clean |
Cc1cn([C@@H]2C[C@@H](O)[C@@H](COP(=O)(O)O)O2)c(…
|
| ZINC1532628 ZINC | 0.804 | 322.2 Da LogP -1.40 TPSA 151.1 | ✓ Ro5 | ✓ Clean |
Cc1cn([C@@H]2C[C@@H](O)[C@H](COP(=O)(O)O)O2)c(=…
|
| ZINC1678872 ZINC | 0.804 | 322.2 Da LogP -1.40 TPSA 151.1 | ✓ Ro5 | ✓ Clean |
Cc1cn([C@H]2C[C@H](O)[C@@H](COP(=O)(O)O)O2)c(=O…
|
| ZINC2047010 ZINC | 0.804 | 322.2 Da LogP -1.40 TPSA 151.1 | ✓ Ro5 | ✓ Clean |
Cc1cn([C@H]2C[C@@H](O)[C@H](COP(=O)(O)O)O2)c(=O…
|
| ZINC3870253 ZINC | 0.804 | 322.2 Da LogP -1.40 TPSA 151.1 | ✓ Ro5 | ✓ Clean |
Cc1cn([C@@H]2C[C@H](O)[C@H](COP(=O)(O)O)O2)c(=O…
|
| ZINC3870254 ZINC | 0.804 | 322.2 Da LogP -1.40 TPSA 151.1 | ✓ Ro5 | ✓ Clean |
Cc1cn([C@H]2C[C@H](O)[C@H](COP(=O)(O)O)O2)c(=O)…
|
| ZINC6523446 ZINC | 0.804 | 322.2 Da LogP -1.40 TPSA 151.1 | ✓ Ro5 | ✓ Clean |
Cc1cn([C@@H]2C[C@H](O)[C@@H](COP(=O)(O)O)O2)c(=…
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.