KpATCC43816 Protein target profile

ndk

Accession: VK055_4652

Gene: ndk AIK83186.1 3D evidence: AlphaFold DB model + ColabFold model Metabolism 8 reactions UniProt A0A0H3GTL0
Length 143
Pocket druggability (P2Rank · AlphaFold DB model) 0.701
Metabolic reactions 8
Chokepoint Yes
Direct ligand evidence 0 20 total records
Functional annotation 1 EC 7 GO
Target summary

Strong target candidate with converging metabolic, structural and chemical evidence.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
Hit
Human identity (%)
51.389 Lower values reduce human off-target concern.
Human E-value
1.87e-18
Gut microbiome similarity
11.0% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
95.105 Higher values support similarity to known essential genes.
DEG E-value
7.510000000000001e-100 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
96.63 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.701
Structure A0A0H3GTL0
Pocket Pocket 1
Druggability (FPocket) 0.721
Structure A0A0H3GTL0
Pocket Pocket 6
ColabFold model
P2Rank 0.721 · Pocket 1
FPocket 0.666 · Pocket 4
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 524 / 4744 genomes with a hit
Prevalence 11.0%

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

Explore metabolic network

Attractive metabolic target: catalyzes a consuming chokepoint reaction in Purine metabolism, no isoenzyme backup detected, more central than 99.4% of genes in this genome.

Relative network centrality 99.4% more central than 99.4% of genes in this genome
Chokepoint Chokepoint gene
Catalyzed reactions

8 reactions mapped to this gene in the metabolic model. Open the full network to see each one, with substrates/products and the reaction-reaction map.

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MAIERTFSIIKPNAVAKNVIGSIFSRFEAAGFKIVGTKMLHLTVEQARGFYAEHEGRPFFDGLVEFMTSGPIVVSVLEGENAVQRHRDLLGATNPANALAGTLRADYADSFTENGTHGSDSVESAAREIAFFFAEGEVCPRTR

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 7 GO

Subcellular localization

Localization
Cytoplasmic

Enzyme Commission (EC)

1

Gene Ontology (GO)

7
  • GO:0004550 Catalysis of the reaction: ATP + nucleoside diphosphate = ADP + nucleoside triphosphate.
  • GO:0006241 The chemical reactions and pathways resulting in the formation of CTP, cytidine 5'-triphosphate.
  • GO:0006228 The chemical reactions and pathways resulting in the formation of UTP, uridine (5'-)triphosphate.
  • GO:0006183 The chemical reactions and pathways resulting in the formation of GTP, guanosine triphosphate.
  • GO:0005737 The contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
  • GO:0005524 Binding to ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
  • GO:0046872 Binding to a metal ion.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

25 records
Show feature table
Start End DB Term Name
70 87 PRINTS PR01243 Nucleoside diphosphate kinase signature
70 87 InterPro IPR001564 Nucleoside diphosphate kinase
50 69 PRINTS PR01243 Nucleoside diphosphate kinase signature
50 69 InterPro IPR001564 Nucleoside diphosphate kinase
91 107 PRINTS PR01243 Nucleoside diphosphate kinase signature
91 107 InterPro IPR001564 Nucleoside diphosphate kinase
6 28 PRINTS PR01243 Nucleoside diphosphate kinase signature
6 28 InterPro IPR001564 Nucleoside diphosphate kinase
114 133 PRINTS PR01243 Nucleoside diphosphate kinase signature
114 133 InterPro IPR001564 Nucleoside diphosphate kinase
1 139 Gene3D G3DSA:3.30.70.141 -
1 139 InterPro IPR036850 Nucleoside diphosphate kinase-like domain superfamily
2 134 PANTHER PTHR46161 NUCLEOSIDE DIPHOSPHATE KINASE
114 122 ProSitePatterns PS00469 Nucleoside diphosphate kinases active site.
114 122 InterPro IPR023005 Nucleoside diphosphate kinase, active site
4 133 CDD cd04413 NDPk_I
3 140 SMART SM00562 ndk_5
3 140 InterPro IPR034907 Nucleoside diphosphate kinase-like domain
1 141 SUPERFAMILY SSF54919 Nucleoside diphosphate kinase, NDK
1 141 InterPro IPR036850 Nucleoside diphosphate kinase-like domain superfamily
4 137 Pfam PF00334 Nucleoside diphosphate kinase
4 137 InterPro IPR034907 Nucleoside diphosphate kinase-like domain
3 138 Hamap MF_00451 Nucleoside diphosphate kinase [ndk].
3 138 InterPro IPR001564 Nucleoside diphosphate kinase
1 139 FunFam G3DSA:3.30.70.141:FF:000001 Nucleoside diphosphate kinase

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.701
Likely same site as FPocket 6 7.0 Å 10 shared residues 83% of smaller site
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #6
0.721
Likely same site as P2Rank 1 7.0 Å 10 shared residues 83% of smaller site
Show in viewer
Surrounding area
Residue sets
UniProt: Active site:117-117 Pros-phosphohistidine intermediate
UniProt: Binding site:104-104
UniProt: Binding site:11-11
UniProt: Binding site:114-114
UniProt: Binding site:59-59
UniProt: Binding site:87-87
UniProt: Binding site:93-93
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GTL0
AlphaFold DB full sequence Viewing
ColabFold VK055_4652
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

20 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 3 records from similar proteins
Structural ligands 3 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 17 similarity-based ZINC candidates
Best available ligand signal
DTT PDB via homolog 154.3 Da · LogP -0.43 · TPSA 40.5 Open detail RCSB PDB
PHS PDB via homolog Detail RCSB PDB
VO4 PDB via homolog Detail RCSB PDB
ZINC1532902 ZINC proposed compound · Tanimoto 0.700 Detail ZINC
ZINC2018106 ZINC proposed compound · Tanimoto 0.700 Detail ZINC

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
DTT RCSB PDB Q9U1E1 154.3 Da LogP -0.43 TPSA 40.5 ✓ Ro5 ✓ Clean C([C@@H]([C@H](CS)O)O)S
PHS RCSB PDB Q5SLV5 82.0 Da LogP -0.64 TPSA 57.5 ✓ Ro5 ✓ Clean OP(=O)O
VO4 RCSB PDB Q5HFV4 114.9 Da LogP -3.69 TPSA 86.2 ✓ Ro5 ✓ Clean [O-][V](=O)([O-])[O-]

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.