KpATCC43816 Protein target profile
phosphoribosylglycinamide formyltransferase
Accession: VK055_4685
Promising target candidate with multiple supporting evidence streams.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Evidence coverage
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- Hit
- Human identity (%)
- 43.972 Lower values reduce human off-target concern.
- Human E-value
- 1.32e-35
- Gut microbiome similarity
- 3.7% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- Y
- DEG identity (%)
- 58.373 Higher values support similarity to known essential genes.
- DEG E-value
- 6.77e-86 Smaller values mean stronger essential-gene similarity.
Structure confidence
- ColabFold pLDDT
- 96.63 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MKNIVVLISGSGSNLQAIIDACGRKQINGTLRAVFSNKADAFGLERARLAGIPAHALAQSQFADREAFDRQLMHEIDAYAPDLVVLAGYMRILSPAFVSHYQGRLLNIHPSLLPKYPGLHTHRQVLENGDEEHGTSVHFVTDELDGGPVILQAKVPVFAGDSEEEITARVQTQEHAIYPLVISWFVDGRLRMAGNHAWLDERQLPPQGYAADE
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- Cytoplasmic
Enzyme Commission (EC)
1Gene Ontology (GO)
4- GO:0009058 A cellular process consisting of the biochemical pathways by which a living organism synthesizes chemical substances. This typically represents the energy-requiring part of metabolism in which simpler substances are transformed into more complex ones.
- GO:0004644 Catalysis of the reaction: 10-formyltetrahydrofolate + N1-(5-phospho-D-ribosyl)glycinamide = tetrahydrofolate + N2-formyl-N1-(5-phospho-D-ribosyl)glycinamide.
- GO:0006189 The chemical reactions and pathways resulting in the formation of IMP, inosine monophosphate, by the stepwise assembly of a purine ring on ribose 5-phosphate.
- GO:0005829 The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 2 | 199 | PANTHER | PTHR43369 | PHOSPHORIBOSYLGLYCINAMIDE FORMYLTRANSFERASE |
| 2 | 182 | Pfam | PF00551 | Formyl transferase |
| 2 | 182 | InterPro | IPR002376 | Formyl transferase, N-terminal |
| 18 | 213 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 1 | 17 | Phobius | SIGNAL_PEPTIDE | Signal peptide region |
| 4 | 12 | Phobius | SIGNAL_PEPTIDE_H_REGION | Hydrophobic region of a signal peptide. |
| 3 | 185 | CDD | cd08645 | FMT_core_GART |
| 3 | 185 | InterPro | IPR004607 | Phosphoribosylglycinamide formyltransferase |
| 2 | 192 | NCBIfam | TIGR00639 | phosphoribosylglycinamide formyltransferase |
| 2 | 192 | InterPro | IPR004607 | Phosphoribosylglycinamide formyltransferase |
| 2 | 213 | Gene3D | G3DSA:3.40.50.170 | - |
| 2 | 213 | FunFam | G3DSA:3.40.50.170:FF:000005 | Phosphoribosylglycinamide formyltransferase |
| 2 | 204 | SUPERFAMILY | SSF53328 | Formyltransferase |
| 2 | 204 | InterPro | IPR036477 | Formyl transferase, N-terminal domain superfamily |
| 3 | 188 | Hamap | MF_01930 | Phosphoribosylglycinamide formyltransferase [purN]. |
| 3 | 188 | InterPro | IPR004607 | Phosphoribosylglycinamide formyltransferase |
| 13 | 17 | Phobius | SIGNAL_PEPTIDE_C_REGION | C-terminal region of a signal peptide. |
| 1 | 3 | Phobius | SIGNAL_PEPTIDE_N_REGION | N-terminal region of a signal peptide. |
| 134 | 157 | ProSitePatterns | PS00373 | Phosphoribosylglycinamide formyltransferase active site. |
| 134 | 157 | InterPro | IPR001555 | Phosphoribosylglycinamide formyltransferase, active site |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Residue sets
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Residue sets
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GWL7
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
VK055_4685
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural and bioactivity evidence are both available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| 138 RCSB PDB | P08179 | 752.6 Da LogP -2.34 TPSA 353.5 | 3 viol. | ✓ Clean |
c1cc(ccc1C(=O)N[C@@H](CCC(=O)O)C(=O)O)[C@@](Cc2…
|
|
| 3YA RCSB PDB | P22102 | 472.5 Da LogP 2.18 TPSA 175.5 | ✓ Ro5 | ✓ Clean |
c1cc(ccc1CCCCc2cc3c(s2)NC(=NC3=O)N)C(=O)N[C@@H]…
|
|
| 3YB RCSB PDB | P22102 | 461.5 Da LogP 1.51 TPSA 191.3 | 1 viol. | ✓ Clean |
c1c(csc1C(=O)N[C@@H](CCC(=O)O)C(=O)O)CCCCc2cc3c…
|
|
| 3YC RCSB PDB | P22102 | 461.5 Da LogP 1.51 TPSA 191.3 | 1 viol. | ✓ Clean |
c1c(csc1CCCCc2cc3c([nH]2)N=C(NC3=O)N)C(=O)N[C@@…
|
|
| 3YD RCSB PDB | P22102 | 407.4 Da LogP 0.76 TPSA 191.3 | 1 viol. | ✓ Clean |
c1c([nH]c2c1C(=O)NC(=N2)N)CCCCCCC(=O)N[C@@H](CC…
|
|
| 3YE RCSB PDB | P22102 | 421.5 Da LogP 1.15 TPSA 191.3 | 1 viol. | ✓ Clean |
c1c([nH]c2c1C(=O)NC(=N2)N)CCCCCCCC(=O)N[C@@H](C…
|
|
| 3YF RCSB PDB | P22102 | 447.5 Da LogP 1.12 TPSA 191.3 | 1 viol. | ✓ Clean |
c1c(csc1C(=O)N[C@@H](CCC(=O)O)C(=O)O)CCCc2cc3c(…
|
|
| 3YG RCSB PDB | P22102 | 447.5 Da LogP 1.12 TPSA 191.3 | 1 viol. | ✓ Clean |
c1c(csc1CCCc2cc3c([nH]2)N=C(NC3=O)N)C(=O)N[C@@H…
|
|
| 4DW RCSB PDB | P22102 | 425.4 Da LogP 0.44 TPSA 191.3 | 1 viol. | ✓ Clean |
c1cc(ccc1CCc2c[nH]c3c2C(=O)N=C(N3)N)C(=O)N[C@@H…
|
|
| 83A RCSB PDB | P22102 | 442.4 Da LogP 0.54 TPSA 203.3 | 1 viol. | ✓ Clean |
c1cc(ccc1C(=O)N[C@@H](CCC(=O)O)C(=O)O)NCCc2cc3c…
|
|
| DXZ RCSB PDB | P22102 | 477.5 Da LogP 1.41 TPSA 201.5 | 1 viol. | ✓ Clean |
CS[C@H](CCCC1=C(N=C(NC1=O)N)N)c2ccc(cc2)C(=O)N[…
|
|
| DZF RCSB PDB | P08179 | 440.4 Da LogP 0.56 TPSA 200.4 | 1 viol. | ✓ Clean |
c1cc(ccc1C(=O)N[C@@H](CCC(=O)O)C(=O)O)NCc2cc3c(…
|
|
| G71 RCSB PDB | P22102 | 461.5 Da LogP 1.51 TPSA 191.3 | 1 viol. | ✓ Clean |
c1cc(sc1CCCCc2cc3c([nH]2)NC(=NC3=O)N)C(=O)N[C@@…
|
|
| G94 RCSB PDB | P22102 | 447.5 Da LogP 1.12 TPSA 191.3 | 1 viol. | ✓ Clean |
c1cc(sc1CCCc2cc3c([nH]2)NC(=NC3=O)N)C(=O)N[C@@H…
|
|
| GAR RCSB PDB | P22102 | 284.2 Da LogP -4.65 TPSA 177.2 | ✓ Ro5 | ✓ Clean |
C([C@@H]1[C@H]([C@H]([C@@H](O1)NC(=O)CN)O)O)OP(…
|
|
| KEU RCSB PDB | P22102 | 549.5 Da LogP -0.91 TPSA 237.3 | 2 viol. | ✓ Clean |
c1cc(ccc1[C@@H](CCCC2C(NC(NC2=O)N)N)C(C(F)(F)F)…
|
|
| KT3 RCSB PDB | P22102 | 803.7 Da LogP -0.56 TPSA 375.0 | 3 viol. | ✓ Clean |
c1cc(ccc1[C@H](CCCc2c(nc(nc2O)N)N)C(C(F)(F)F)(O…
|
|
| KT5 RCSB PDB | P22102 | 1061.9 Da LogP -1.86 TPSA 507.8 | 3 viol. | ✓ Clean |
c1cc(ccc1[C@H](CCCc2c(nc(nc2O)N)N)C(C(F)(F)F)(O…
|
|
| NHE RCSB PDB | Q83AY9 | 207.3 Da LogP 0.80 TPSA 66.4 | ✓ Ro5 | ✓ Clean |
C1CCC(CC1)NCCS(=O)(=O)O
|
|
| NHR RCSB PDB | P08179 | 482.4 Da LogP 1.38 TPSA 213.0 | 1 viol. | ✓ Clean |
c1cc(ccc1[C@@H](Cc2ccc3c(c2)c(nc(n3)N)O)C(=O)O)…
|
|
| NHS RCSB PDB | P08179 | 482.4 Da LogP 0.96 TPSA 212.8 | 1 viol. | ✓ Clean |
c1cc(ccc1[C@H](Cc2ccc3c(c2)C(=O)NC(=N3)N)C(=O)O…
|
|
| U89 RCSB PDB | P08179 | 715.7 Da LogP -0.31 TPSA 317.7 | 3 viol. | ✓ Clean |
c1cc(ccc1C(=O)N[C@@H](CCC(=O)O)C(=O)O)N(CCCC2=C…
|
|
| V97 RCSB PDB | P22102 | 478.6 Da LogP 2.24 TPSA 175.5 | ✓ Ro5 | ✓ Clean |
c1cc(sc1CCCCc2cc3c(s2)N=C(NC3=O)N)C(=O)N[C@@H](…
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
| Ligand | UniProt (homolog) | pchembl | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| CHEMBL279302 ChEMBL | Q64737 | 10.74 ~0.0 nM | 458.5 Da LogP 1.04 TPSA 199.8 | 1 viol. | ✓ Clean |
Nc1nc(O)c2c(n1)NCC(CCCc1ccc(C(=O)NC(CCC(=O)O)C(…
|
| CHEMBL607957 ChEMBL | Q64737 | 9.60 ~0.3 nM | 782.7 Da LogP -1.10 TPSA 341.6 | 3 viol. | ✓ Clean |
Nc1nc(O)c2cc(CN(C(=O)CSCC(=O)NC3O[C@H](COP(=O)(…
|
| CHEMBL4643623 ChEMBL | P22102 | 9.52 ~0.3 nM | 473.5 Da LogP 1.61 TPSA 191.3 | 1 viol. | ✓ Clean |
Nc1nc2[nH]c(CCCSc3ccc(C(=O)N[C@@H](CCC(=O)O)C(=…
|
| CHEMBL4465095 ChEMBL | P22102 | 9.15 ~0.7 nM | 479.5 Da LogP 1.65 TPSA 191.3 | 1 viol. | ✓ Clean |
Nc1nc2[nH]c(CCCCc3csc(C(=O)N[C@@H](CCC(=O)O)C(=…
|
| CHEMBL4636872 ChEMBL | P22102 | 9.02 ~1.0 nM | 456.5 Da LogP 0.93 TPSA 203.3 | 1 viol. | ✓ Clean |
Nc1nc2[nH]c(CCCNc3ccc(C(=O)N[C@@H](CCC(=O)O)C(=…
|
| CHEMBL192632 ChEMBL | P22102 | 9.00 ~1.0 nM | 441.4 Da LogP 1.06 TPSA 191.3 | 1 viol. | ✓ Clean |
Nc1nc2[nH]c(CCCc3ccc(C(=O)N[C@@H](CCC(=O)O)C(=O…
|
| CHEMBL4538151 ChEMBL | P22102 | 9.00 ~1.0 nM | 459.4 Da LogP 1.20 TPSA 191.3 | 1 viol. | ✓ Clean |
Nc1nc2[nH]c(CCCc3ccc(C(=O)N[C@@H](CCC(=O)O)C(=O…
|
| CHEMBL4445651 ChEMBL | P22102 | 8.92 ~1.2 nM | 465.5 Da LogP 1.26 TPSA 191.3 | 1 viol. | ✓ Clean |
Nc1nc2[nH]c(CCCc3csc(C(=O)N[C@@H](CCC(=O)O)C(=O…
|
| CHEMBL4214638 ChEMBL | P22102 | 8.89 ~1.3 nM | 456.5 Da LogP 0.84 TPSA 204.2 | 1 viol. | ✓ Clean |
Nc1nc2[nH]c(CCCCc3ccc(C(=O)N[C@@H](CCC(=O)O)C(=…
|
| CHEMBL4557278 ChEMBL | P22102 | 8.70 ~2.0 nM | 474.4 Da LogP 0.98 TPSA 204.1 | 1 viol. | ✓ Clean |
Nc1nc2[nH]c(CCCCc3cnc(C(=O)N[C@@H](CCC(=O)O)C(=…
|
| CHEMBL82261 ChEMBL | P22102 | 8.70 ~2.0 nM | 481.6 Da LogP 1.70 TPSA 187.8 | 1 viol. | ✓ Clean |
Cc1cc(C(=O)N[C@H](CCC(=O)O)C(=O)O)sc1CCC1CNc2nc…
|
| CHEMBL4471269 ChEMBL | P22102 | 8.68 ~2.1 nM | 470.4 Da LogP 0.09 TPSA 211.6 | 1 viol. | ✓ Clean |
Nc1nc2[nH]c(CCN(C=O)c3ccc(C(=O)N[C@@H](CCC(=O)O…
|
| CHEMBL4645676 ChEMBL | P22102 | 8.60 ~2.5 nM | 457.4 Da LogP 0.89 TPSA 200.5 | 1 viol. | ✓ Clean |
Nc1nc2[nH]c(CCCOc3ccc(C(=O)N[C@@H](CCC(=O)O)C(=…
|
| CHEMBL85436 ChEMBL | P22102 | 8.52 ~3.0 nM | 467.5 Da LogP 1.39 TPSA 187.8 | 1 viol. | ✓ Clean |
Nc1nc(O)c2c(n1)NCC(CCc1ccc(C(=O)N[C@H](CCC(=O)O…
|
| CHEMBL82181 ChEMBL | P22102 | 8.47 ~3.4 nM | 461.5 Da LogP 1.33 TPSA 187.8 | 1 viol. | ✓ Clean |
Nc1nc(O)c2c(n1)NCC(CCc1cccc(C(=O)NC(CCC(=O)O)C(…
|
| CHEMBL4205344 ChEMBL | P22102 | 8.32 ~4.8 nM | 456.5 Da LogP 0.84 TPSA 204.2 | 1 viol. | ✓ Clean |
Nc1nc2[nH]c(CCCCc3ccc(C(=O)N[C@@H](CCC(=O)O)C(=…
|
| CHEMBL4553188 ChEMBL | P22102 | 8.30 ~5.0 nM | 538.4 Da LogP 1.02 TPSA 211.6 | 2 viol. | ✓ Clean |
Nc1nc2[nH]c(CCN(C(=O)C(F)(F)F)c3ccc(C(=O)N[C@@H…
|
| CHEMBL4467936 ChEMBL | P22102 | 8.28 ~5.2 nM | 459.5 Da LogP 1.22 TPSA 191.3 | 1 viol. | ✓ Clean |
Nc1nc2[nH]c(CCSc3ccc(C(=O)N[C@@H](CCC(=O)O)C(=O…
|
| CHEMBL4638232 ChEMBL | P22102 | 8.27 ~5.4 nM | 552.5 Da LogP 1.41 TPSA 211.6 | 2 viol. | ✓ Clean |
Nc1nc2[nH]c(CCCN(C(=O)C(F)(F)F)c3ccc(C(=O)N[C@@…
|
| CHEMBL4444011 ChEMBL | P22102 | 8.25 ~5.6 nM | 484.5 Da LogP 0.48 TPSA 211.6 | 1 viol. | ✓ Clean |
CC(=O)N(CCc1cc2c(=O)[nH]c(N)nc2[nH]1)c1ccc(C(=O…
|
| CHEMBL4447805 ChEMBL | P22102 | 8.18 ~6.6 nM | 443.4 Da LogP 0.50 TPSA 200.5 | 1 viol. | ✓ Clean |
Nc1nc2[nH]c(CCOc3ccc(C(=O)N[C@@H](CCC(=O)O)C(=O…
|
| CHEMBL502528 ChEMBL | P22102 | 8.14 ~7.2 nM | 469.5 Da LogP 1.84 TPSA 191.3 | 1 viol. | ✓ Clean |
Nc1nc2[nH]c(CCCCCc3ccc(C(=O)N[C@@H](CCC(=O)O)C(…
|
| CHEMBL526928 ChEMBL | P22102 | 8.07 ~8.5 nM | 483.5 Da LogP 2.23 TPSA 191.3 | 1 viol. | ✓ Clean |
Nc1nc2[nH]c(CCCCCCc3ccc(C(=O)N[C@@H](CCC(=O)O)C…
|
| CHEMBL84935 ChEMBL | P22102 | 8.07 ~8.5 nM | 469.5 Da LogP 1.49 TPSA 201.7 | 1 viol. | ✓ Clean |
Cc1cc(CCCSc2c(N)nc(N)nc2O)sc1C(=O)N[C@@H](CCC(=…
|
| CHEMBL3086867 ChEMBL | P22102 | 8.02 ~9.5 nM | 435.5 Da LogP 1.54 TPSA 191.3 | 1 viol. | ✓ Clean |
Nc1nc2[nH]c(CCCCCCCCC(=O)N[C@@H](CCC(=O)O)C(=O)…
|
| CHEMBL267890 ChEMBL | Q64737 | 8.00 ~10.0 nM | 471.5 Da LogP 1.98 TPSA 187.8 | 1 viol. | ✓ Clean |
CCC1c2c(O)nc(N)nc2NCC1CCc1ccc(C(=O)NC(CCC(=O)O)…
|
| LYA ChEMBL | P22102 | 7.93 ~11.7 nM | 427.4 Da LogP 0.67 TPSA 191.3 | 1 viol. | ✓ Clean |
c1cc(ccc1CCc2c[nH]c3c2C(=O)N=C(N3)N)C(=O)N[C@@H…
|
| CHEMBL3335605 ChEMBL | P22102 | 7.92 ~12.0 nM | 461.5 Da LogP 1.51 TPSA 191.3 | 1 viol. | ✓ Clean |
Nc1nc2[nH]c(CCCc3ccc(C(=O)N[C@@H](CCCC(=O)O)C(=…
|
| CHEMBL4641908 ChEMBL | P22102 | 7.88 ~13.2 nM | 484.5 Da LogP 0.48 TPSA 211.6 | 1 viol. | ✓ Clean |
Nc1nc2[nH]c(CCCN(C=O)c3ccc(C(=O)N[C@@H](CCC(=O)…
|
| CHEMBL490934 ChEMBL | P22102 | 7.86 ~13.8 nM | 458.5 Da LogP 1.79 TPSA 175.5 | ✓ Ro5 | ✓ Clean |
Nc1nc2sc(CCCc3ccc(C(=O)N[C@@H](CCC(=O)O)C(=O)O)…
|
| CHEMBL451819 ChEMBL | P22102 | 7.85 ~14.1 nM | 459.5 Da LogP 0.29 TPSA 218.6 | 1 viol. | ✓ Clean |
Nc1nc(N)c(CCCC(C=O)c2ccc(C(=O)N[C@@H](CCC(=O)O)…
|
| CHEMBL84605 ChEMBL | P22102 | 7.85 ~14.1 nM | 483.6 Da LogP 1.74 TPSA 201.7 | 1 viol. | ✓ Clean |
CCc1cc(CCCSc2c(N)nc(N)nc2O)sc1C(=O)N[C@@H](CCC(…
|
| CHEMBL451818 ChEMBL | P22102 | 7.82 ~15.1 nM | 527.5 Da LogP 1.22 TPSA 218.6 | 2 viol. | ✓ Clean |
Nc1nc(N)c(CCCC(C(=O)C(F)(F)F)c2ccc(C(=O)N[C@@H]…
|
| CHEMBL82390 ChEMBL | P22102 | 7.82 ~15.1 nM | 481.6 Da LogP 1.70 TPSA 187.8 | 1 viol. | ✓ Clean |
Cc1cc(C(=O)N[C@@H](CCC(=O)O)C(=O)O)sc1CCC1CNc2n…
|
| CHEMBL350097 ChEMBL | P22102 | 7.79 ~16.2 nM | 439.4 Da LogP 1.15 TPSA 188.6 | ✓ Ro5 | ✓ Clean |
Nc1nc(O)c2cc(CCc3ccc(C(=O)N[C@@H](CCC(=O)O)C(=O…
|
| CHEMBL491129 ChEMBL | P22102 | 7.63 ~23.4 nM | 486.6 Da LogP 2.57 TPSA 175.5 | ✓ Ro5 | ✓ Clean |
Nc1nc2sc(CCCCCc3ccc(C(=O)N[C@@H](CCC(=O)O)C(=O)…
|
| CHEMBL491298 ChEMBL | P22102 | 7.58 ~26.3 nM | 500.6 Da LogP 2.96 TPSA 175.5 | 1 viol. | ✓ Clean |
Nc1nc2sc(CCCCCCc3ccc(C(=O)N[C@@H](CCC(=O)O)C(=O…
|
| CHEMBL84163 ChEMBL | P22102 | 7.55 ~28.2 nM | 467.5 Da LogP 1.39 TPSA 187.8 | 1 viol. | ✓ Clean |
Nc1nc(O)c2c(n1)NCC(CCc1ccc(C(=O)N[C@@H](CCC(=O)…
|
| CHEMBL309415 ChEMBL | P22102 | 7.52 ~30.2 nM | 481.6 Da LogP 1.35 TPSA 201.7 | 1 viol. | ✓ Clean |
Nc1nc(N)c(SCC2CCc3cc(C(=O)N[C@@H](CCC(=O)O)C(=O…
|
| CHEMBL379094 ChEMBL | P22102 | 7.52 ~30.2 nM | 527.5 Da LogP 1.63 TPSA 218.8 | 2 viol. | ✓ Clean |
Nc1nc(N)c(CCCC(C(=O)C(F)(F)F)c2ccc(C(=O)NC(CCC(…
|
| CHEMBL315627 ChEMBL | P22102 | 7.50 ~31.6 nM | 469.5 Da LogP 1.49 TPSA 201.8 | 1 viol. | ✓ Clean |
Cc1cc(C(=O)N[C@@H](CCC(=O)O)C(=O)O)sc1CCCSc1c(N…
|
| CHEMBL522455 ChEMBL | P22102 | 7.49 ~32.4 nM | 444.5 Da LogP 1.40 TPSA 175.5 | ✓ Ro5 | ✓ Clean |
Nc1nc2sc(CCc3ccc(C(=O)N[C@@H](CCC(=O)O)C(=O)O)c…
|
| CHEMBL315076 ChEMBL | P22102 | 7.46 ~34.7 nM | 461.5 Da LogP 1.33 TPSA 187.8 | 1 viol. | ✓ Clean |
Nc1nc(O)c2c(n1)NCC(CCc1ccc(C(=O)NC(CCC(=O)O)C(=…
|
| CHEMBL85871 ChEMBL | P22102 | 7.46 ~34.7 nM | 455.5 Da LogP 1.18 TPSA 201.7 | 1 viol. | ✓ Clean |
Nc1nc(N)c(SCCCc2ccc(C(=O)N[C@@H](CCC(=O)O)C(=O)…
|
| CHEMBL84904 ChEMBL | P22102 | 7.42 ~38.0 nM | 449.5 Da LogP 1.12 TPSA 201.7 | 1 viol. | ✓ Clean |
Nc1nc(N)c(SCCCc2ccc(C(=O)N[C@@H](CCC(=O)O)C(=O)…
|
| CHEMBL4642637 ChEMBL | P22102 | 7.40 ~39.8 nM | 498.5 Da LogP 0.87 TPSA 211.6 | 1 viol. | ✓ Clean |
CC(=O)N(CCCc1cc2c(=O)[nH]c(N)nc2[nH]1)c1ccc(C(=…
|
| CHEMBL38902 ChEMBL | Q64737 | 7.33 ~46.8 nM | 480.4 Da LogP 0.21 TPSA 220.0 | 1 viol. | ✓ Clean |
Nc1nc(O)c2c(n1)NCC(CNc1ccc(C(=O)NC(CCP(=O)(O)O)…
|
| DDF ChEMBL | Q64737 | 7.22 ~60.3 nM | 443.5 Da LogP 0.62 TPSA 187.5 | 1 viol. | ✓ Clean |
c1cc(ccc1CC[C@@H]2CC3=C(NC2)NC(=NC3=O)N)C(=O)N[…
|
| CHEMBL3409335 ChEMBL | P22102 | 7.21 ~61.7 nM | 461.5 Da LogP 1.51 TPSA 191.3 | 1 viol. | ✓ Clean |
Nc1nc2[nH]cc(CCCCc3ccc(C(=O)N[C@@H](CCC(=O)O)C(…
|
| CHEMBL279508 ChEMBL | Q64737 | 7.19 ~64.6 nM | 443.5 Da LogP 1.03 TPSA 187.8 | 1 viol. | ✓ Clean |
Nc1nc(O)c2c(n1)CCC(CNc1ccc(C(=O)NC(CCC(=O)O)C(=…
|
| CHEMBL314116 ChEMBL | Q64737 | 7.19 ~64.6 nM | 427.5 Da LogP 1.32 TPSA 167.5 | ✓ Ro5 | ✓ Clean |
Nc1ncc2c(n1)NCC(CCc1ccc(C(=O)N[C@@H](CCC(=O)O)C…
|
| CHEMBL3628345 ChEMBL | P22102 | 7.09 ~81.3 nM | 447.5 Da LogP 1.67 TPSA 194.7 | ✓ Ro5 | ✓ Clean |
Nc1nc(N)c2c(CCCc3csc(C(=O)N[C@@H](CCC(=O)O)C(=O…
|
| CHEMBL3628347 ChEMBL | P22102 | 7.00 ~100.0 nM | 447.5 Da LogP 1.67 TPSA 194.7 | ✓ Ro5 | ✓ Clean |
Nc1nc(N)c2c(CCCc3cc(C(=O)N[C@@H](CCC(=O)O)C(=O)…
|
| CHEMBL170101 ChEMBL | Q64737 | 6.92 ~120.2 nM | 443.5 Da LogP 1.03 TPSA 187.8 | 1 viol. | ✓ Clean |
Nc1nc(O)c2c(n1)NCC(CCc1ccc(C(=O)NC(CCC(=O)O)C(=…
|
| CHEMBL424683 ChEMBL | P22102 | 6.89 ~128.8 nM | 551.5 Da LogP 0.91 TPSA 236.0 | 3 viol. | ✓ Clean |
Nc1nc(N)c(CCCC(C(=O)C(F)(F)F)c2ccc(C(=O)NC(CCc3…
|
| CHEMBL294768 ChEMBL | P22102 | 6.85 ~141.3 nM | 439.5 Da LogP -0.10 TPSA 226.7 | 2 viol. | ✓ Clean |
Nc1nc(N)c(CCCNc2cnc(C(=O)N[C@@H](CCC(=O)O)C(=O)…
|
| CHEMBL3085263 ChEMBL | Q64737 | 6.83 ~147.9 nM | 456.5 Da LogP 2.02 TPSA 174.9 | 1 viol. | ✓ Clean |
Nc1cc2c(c(O)n1)CC(CCc1ccc(C(=O)N[C@@H](CCC(=O)O…
|
| 3Y9 ChEMBL | Q64737 | 6.82 ~151.4 nM | 455.5 Da LogP 1.45 TPSA 191.3 | 1 viol. | ✓ Clean |
c1cc(ccc1CCCCc2cc3c([nH]2)N=C(NC3=O)N)C(=O)N[C@…
|
| DXY ChEMBL | P22102 | 6.75 ~177.8 nM | 477.5 Da LogP 1.41 TPSA 201.5 | 1 viol. | ✓ Clean |
CS[C@@H](CCCC1=C(N=C(NC1=O)N)N)c2ccc(cc2)C(=O)N…
|
| CHEMBL417696 ChEMBL | Q64737 | 6.72 ~190.5 nM | 480.5 Da LogP -0.08 TPSA 216.9 | 1 viol. | ✓ Clean |
Nc1nc(O)c2c(n1)NCC(CNc1ccc(C(=O)NC(CCS(=O)(=O)O…
|
| CHEMBL5417651 ChEMBL | P22102 | 6.55 ~281.8 nM | 455.5 Da LogP 1.38 TPSA 180.4 | ✓ Ro5 | ✓ Clean |
Nc1nc2ccn(CCCCc3ccc(C(=O)N[C@@H](CCC(=O)O)C(=O)…
|
| CHEMBL5429283 ChEMBL | P22102 | 6.48 ~331.1 nM | 475.5 Da LogP 1.83 TPSA 180.4 | ✓ Ro5 | ✓ Clean |
Nc1nc2ccn(CCCCCc3ccc(C(=O)N[C@@H](CCC(=O)O)C(=O…
|
| CHEMBL5438587 ChEMBL | P22102 | 6.42 ~380.2 nM | 469.5 Da LogP 1.77 TPSA 180.4 | ✓ Ro5 | ✓ Clean |
Nc1nc2ccn(CCCCCc3ccc(C(=O)N[C@@H](CCC(=O)O)C(=O…
|
| CHEMBL257691 ChEMBL | P22102 | 6.22 ~602.6 nM | 576.6 Da LogP 2.11 TPSA 244.6 | 2 viol. | ✓ Clean |
Nc1nc(N)c(CCCC(C(=O)c2nc3ccccc3o2)c2ccc(C(=O)N[…
|
| CHEMBL66389 ChEMBL | Q64737 | 6.14 ~724.4 nM | 457.5 Da LogP 1.59 TPSA 187.8 | 1 viol. | ✓ Clean |
CC1c2c(O)nc(N)nc2NCC1CCc1ccc(C(=O)NC(CCC(=O)O)C…
|
| CHEMBL84045 ChEMBL | P22102 | 6.08 ~831.8 nM | 449.5 Da LogP 1.12 TPSA 201.7 | 1 viol. | ✓ Clean |
Nc1nc(N)c(SCCCc2cccc(C(=O)N[C@@H](CCC(=O)O)C(=O…
|
| CHEMBL452324 ChEMBL | P22102 | 6.07 ~851.1 nM | 461.5 Da LogP 0.69 TPSA 210.7 | 1 viol. | ✓ Clean |
CO[C@H](CCCc1c(N)nc(N)[nH]c1=O)c1ccc(C(=O)N[C@@…
|
| CHEMBL2107361 ChEMBL | P22102 | — | 463.5 Da LogP 0.99 TPSA 187.5 | 1 viol. | ✓ Clean |
Cc1cc(C(=O)N[C@@H](CCC(=O)O)C(=O)O)sc1CC[C@@H]1…
|
| CHEMBL2360464 ChEMBL | P22102 | — | 471.4 Da LogP -8.00 TPSA 196.9 | ✓ Ro5 | ✓ Clean |
Nc1nc2[nH]cc(CCc3ccc(C(=O)N[C@@H](CCC(=O)[O-])C…
|
| CHEMBL3989962 ChEMBL | P22102 | — | 705.7 Da LogP -5.66 TPSA 427.7 | 3 viol. | ✓ Clean |
NC(CO)(CO)CO.NC(CO)(CO)CO.Nc1nc(=O)c2c(CCc3ccc(…
|
| CHEMBL4435608 ChEMBL | P22102 | — | 470.4 Da LogP 0.15 TPSA 211.6 | 1 viol. | ✓ Clean |
CN(Cc1cc2c(=O)[nH]c(N)nc2[nH]1)C(=O)c1ccc(C(=O)…
|
| CHEMBL4515056 ChEMBL | P22102 | — | 476.5 Da LogP 0.21 TPSA 211.6 | 1 viol. | ✓ Clean |
CN(Cc1cc2c(=O)[nH]c(N)nc2[nH]1)C(=O)c1ccc(C(=O)…
|
| CHEMBL5315053 ChEMBL | P22102 | — | 445.4 Da LogP -0.16 TPSA 222.8 | 1 viol. | ✓ Clean |
Nc1nc2[nH]cc(CCc3ccc(C(=O)N[C@@H](CCC(=O)O)C(=O…
|
| CHEMBL6068329 ChEMBL | P22102 | — | 503.6 Da LogP -8.00 TPSA 196.9 | 1 viol. | ✓ Clean |
Nc1nc2[nH]cc(CCc3ccc(C(=O)N[C@@H](CCC(=O)[O-])C…
|
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC1637602 ZINC | 1.000 | 443.5 Da LogP 0.62 TPSA 187.5 | 1 viol. | ✓ Clean |
Nc1nc(=O)c2c([nH]1)NC[C@@H](CCc1ccc(C(=O)N[C@@H…
|
| ZINC1710230 ZINC | 1.000 | 207.3 Da LogP 0.80 TPSA 66.4 | ✓ Ro5 | ✓ Clean |
O=S(=O)(O)CCNC1CCCCC1
|
| ZINC8577213 ZINC | 1.000 | 443.5 Da LogP 1.03 TPSA 187.8 | 1 viol. | ✓ Clean |
Nc1nc(O)c2c(n1)NC[C@H](CCc1ccc(C(=O)N[C@@H](CCC…
|
| ZINC1689613 ZINC | 0.855 | 442.5 Da LogP 0.91 TPSA 193.5 | 1 viol. | ✓ Clean |
Nc1nc(N)c2c(n1)CC[C@H](CNc1ccc(C(=O)N[C@@H](CCC…
|
| ZINC1689614 ZINC | 0.855 | 442.5 Da LogP 0.91 TPSA 193.5 | 1 viol. | ✓ Clean |
Nc1nc(N)c2c(n1)CC[C@@H](CNc1ccc(C(=O)N[C@@H](CC…
|
| ZINC1689615 ZINC | 0.855 | 442.5 Da LogP 0.91 TPSA 193.5 | 1 viol. | ✓ Clean |
Nc1nc(N)c2c(n1)CC[C@H](CNc1ccc(C(=O)N[C@H](CCC(…
|
| ZINC1689616 ZINC | 0.855 | 442.5 Da LogP 0.91 TPSA 193.5 | 1 viol. | ✓ Clean |
Nc1nc(N)c2c(n1)CC[C@@H](CNc1ccc(C(=O)N[C@H](CCC…
|
| ZINC6142389 ZINC | 0.803 | 433.4 Da LogP 0.21 TPSA 200.6 | 1 viol. | ✓ Clean |
Nc1nc(=O)c2c([nH]1)NC[C@@H](CCc1ccc(C(=O)N[C@@H…
|
| ZINC13514732 ZINC | 0.790 | 439.4 Da LogP 0.73 TPSA 188.4 | ✓ Ro5 | ✓ Clean |
Nc1nc(=O)c2cc(CCc3ccc(C(=O)N[C@@H](CCC(=O)O)C(=…
|
| ZINC2004372 ZINC | 0.786 | 221.3 Da LogP 1.19 TPSA 66.4 | ✓ Ro5 | ✓ Clean |
O=S(=O)(O)CCCNC1CCCCC1
|
| ZINC38364153 ZINC | 0.786 | 235.3 Da LogP 1.58 TPSA 66.4 | ✓ Ro5 | ✓ Clean |
O=S(=O)(O)CCCCNC1CCCCC1
|
| ZINC4658141 ZINC | 0.785 | 443.5 Da LogP 0.62 TPSA 187.5 | 1 viol. | ✓ Clean |
Nc1nc2c(c(=O)[nH]1)C[C@H](CCc1ccc(C(=O)N[C@H](C…
|
| ZINC4658144 ZINC | 0.785 | 443.5 Da LogP 0.62 TPSA 187.5 | 1 viol. | ✓ Clean |
Nc1nc2c(c(=O)[nH]1)C[C@@H](CCc1ccc(C(=O)N[C@H](…
|
| ZINC72124809 ZINC | 0.769 | 447.5 Da LogP 1.12 TPSA 191.3 | 1 viol. | ✓ Clean |
Nc1nc2[nH]c(CCCc3ccc(C(=O)N[C@@H](CCC(=O)O)C(=O…
|
| ZINC8618632 ZINC | 0.768 | 459.5 Da LogP 0.52 TPSA 211.8 | 1 viol. | ✓ Clean |
Nc1nc(O)c2c(n1)NC[C@@H](CCNc1ccc(C(=O)N[C@H](CC…
|
| ZINC8627115 ZINC | 0.768 | 459.5 Da LogP 0.52 TPSA 211.8 | 1 viol. | ✓ Clean |
Nc1nc(O)c2c(n1)NC[C@H](CCNc1ccc(C(=O)N[C@H](CCC…
|
| ZINC116645807 ZINC | 0.716 | 447.5 Da LogP 1.12 TPSA 191.3 | 1 viol. | ✓ Clean |
Nc1nc2[nH]c(CCCc3cc(C(=O)N[C@@H](CCC(=O)O)C(=O)…
|
| ZINC256014503 ZINC | 0.691 | 443.4 Da LogP 0.48 TPSA 204.8 | 1 viol. | ✓ Clean |
Nc1nc(O)c2c(n1)NC(=O)[C@@H]2CCc1ccc(C(=O)N[C@@H…
|
| ZINC256014504 ZINC | 0.691 | 443.4 Da LogP 0.48 TPSA 204.8 | 1 viol. | ✓ Clean |
Nc1nc(O)c2c(n1)NC(=O)[C@H]2CCc1ccc(C(=O)N[C@@H]…
|
| ZINC103578168 ZINC | 0.676 | 443.4 Da LogP 0.07 TPSA 204.6 | 1 viol. | ✓ Clean |
Nc1nc(=O)c2c([nH]1)NC(=O)[C@@H]2CCc1ccc(C(=O)N[…
|
| ZINC13887836 ZINC | 0.667 | 429.4 Da LogP 0.54 TPSA 187.5 | 1 viol. | ✓ Clean |
Nc1nc2c(c(=O)[nH]1)[C@@H](CCc1ccc(C(=O)N[C@@H](…
|
| ZINC29318450 ZINC | 0.662 | 458.5 Da LogP 1.04 TPSA 199.8 | 1 viol. | ✓ Clean |
Nc1nc(O)c2c(n1)CC[C@H](CCNc1ccc(C(=O)N[C@@H](CC…
|
| ZINC77301930 ZINC | 0.646 | 431.4 Da LogP -0.20 TPSA 218.6 | 1 viol. | ✓ Clean |
Nc1nc(N)c(C(=O)CCc2ccc(C(=O)N[C@H](CCC(=O)O)C(=…
|
| ZINC1540998 ZINC | 0.632 | 427.4 Da LogP 0.67 TPSA 191.3 | 1 viol. | ✓ Clean |
Nc1nc2[nH]cc(CCc3ccc(C(=O)N[C@@H](CCC(=O)O)C(=O…
|
| ZINC1851132 ZINC | 0.632 | 427.4 Da LogP 0.67 TPSA 191.3 | 1 viol. | ✓ Clean |
Nc1nc2[nH]cc(CCc3ccc(C(=O)N[C@H](CCC(=O)O)C(=O)…
|
| ZINC28260958 ZINC | 0.629 | 454.4 Da LogP 0.52 TPSA 201.2 | ✓ Ro5 | ✓ Clean |
Nc1nc2ncc(CCCc3ccc(C(=O)N[C@@H](CCC(=O)O)C(=O)O…
|
| ZINC13515262 ZINC | 0.623 | 439.4 Da LogP 1.17 TPSA 187.5 | 1 viol. | ✓ Clean |
Nc1nc2ccc(CNc3ccc(C(=O)N[C@@H](CCC(=O)O)C(=O)O)…
|
| ZINC1995991 ZINC | 0.623 | 439.4 Da LogP 1.17 TPSA 187.5 | 1 viol. | ✓ Clean |
Nc1nc2ccc(NCc3ccc(C(=O)N[C@@H](CCC(=O)O)C(=O)O)…
|
| ZINC3806981 ZINC | 0.622 | 433.4 Da LogP 0.21 TPSA 200.6 | 1 viol. | ✓ Clean |
Nc1nc2c(c(=O)[nH]1)C[C@@H](CCc1ccc(C(=O)N[C@@H]…
|
| ZINC17106166 ZINC | 0.614 | 456.5 Da LogP 1.85 TPSA 175.5 | ✓ Ro5 | ✓ Clean |
Nc1nc2ccc(CSc3ccc(C(=O)N[C@H](CCC(=O)O)C(=O)O)c…
|
| ZINC17106187 ZINC | 0.614 | 440.4 Da LogP 1.13 TPSA 184.7 | ✓ Ro5 | ✓ Clean |
Nc1nc2ccc(COc3ccc(C(=O)N[C@H](CCC(=O)O)C(=O)O)c…
|
| ZINC4621661 ZINC | 0.614 | 440.4 Da LogP 1.13 TPSA 184.7 | ✓ Ro5 | ✓ Clean |
Nc1nc2ccc(COc3ccc(C(=O)N[C@@H](CCC(=O)O)C(=O)O)…
|
| ZINC11686992 ZINC | 0.608 | 441.5 Da LogP 1.74 TPSA 181.5 | ✓ Ro5 | ✓ Clean |
Nc1nc(N)c2c(n1)CC[C@@H]2CCCc1ccc(C(=O)N[C@@H](C…
|
| ZINC3789075 ZINC | 0.608 | 441.5 Da LogP 1.74 TPSA 181.5 | ✓ Ro5 | ✓ Clean |
Nc1nc(N)c2c(n1)CC[C@H]2CCCc1ccc(C(=O)N[C@@H](CC…
|
| ZINC13820121 ZINC | 0.606 | 440.4 Da LogP 0.56 TPSA 200.4 | 1 viol. | ✓ Clean |
Nc1nc2ncc(NCc3ccc(C(=O)N[C@@H](CCC(=O)O)C(=O)O)…
|
| ZINC31350053 ZINC | 0.605 | 458.5 Da LogP 0.03 TPSA 208.8 | 1 viol. | ✓ Clean |
CN(C[C@@H]1CNc2nc(N)nc(N)c2N1)c1ccc(C(=O)N[C@@H…
|
| ZINC31350056 ZINC | 0.605 | 458.5 Da LogP 0.03 TPSA 208.8 | 1 viol. | ✓ Clean |
CN(C[C@H]1CNc2nc(N)nc(N)c2N1)c1ccc(C(=O)N[C@@H]…
|
| ZINC77301924 ZINC | 0.597 | 443.4 Da LogP 0.07 TPSA 204.6 | 1 viol. | ✓ Clean |
Nc1nc2c(c(=O)[nH]1)[C@H](CCc1ccc(C(=O)N[C@H](CC…
|
| ZINC223670610 ZINC | 0.595 | 459.5 Da LogP -0.28 TPSA 194.0 | 1 viol. | ✓ Clean |
CN(c1ccc(C(=O)N[C@@H](CCC(=O)O)C(=O)O)cc1)[C@@H…
|
| ZINC3870062 ZINC | 0.595 | 457.4 Da LogP -0.52 TPSA 194.0 | 1 viol. | ✓ Clean |
Nc1nc(=O)c2c([nH]1)NC[C@H]1CN(c3ccc(C(=O)N[C@H]…
|
| ZINC8536462 ZINC | 0.592 | 473.4 Da LogP -0.73 TPSA 219.8 | 1 viol. | ✓ Clean |
Nc1nc(=O)c2c([nH]1)NC[C@H](CN(C=O)c1ccc(C(=O)N[…
|
| ZINC8628600 ZINC | 0.592 | 473.5 Da LogP 0.13 TPSA 202.8 | 1 viol. | ✓ Clean |
CN1c2c([nH]c(N)nc2=O)NC[C@@H]1CCNc1ccc(C(=O)N[C…
|
| ZINC8628601 ZINC | 0.592 | 473.5 Da LogP 0.13 TPSA 202.8 | 1 viol. | ✓ Clean |
CN1c2c([nH]c(N)nc2=O)NC[C@H]1CCNc1ccc(C(=O)N[C@…
|
| ZINC1543800 ZINC | 0.587 | 449.5 Da LogP 0.68 TPSA 187.5 | 1 viol. | ✓ Clean |
Nc1nc2c(c(=O)[nH]1)C[C@@H](CCc1ccc(C(=O)N[C@@H]…
|
| ZINC3806974 ZINC | 0.587 | 449.5 Da LogP 0.68 TPSA 187.5 | 1 viol. | ✓ Clean |
Nc1nc2c(c(=O)[nH]1)C[C@H](CCc1ccc(C(=O)N[C@@H](…
|
| ZINC585668451 ZINC | 0.587 | 459.5 Da LogP 0.14 TPSA 194.2 | 1 viol. | ✓ Clean |
CN(c1ccc(C(=O)N[C@H](CCC(=O)O)C(=O)O)cc1)[C@@H]…
|
| ZINC8628705 ZINC | 0.582 | 470.5 Da LogP 0.19 TPSA 194.0 | 1 viol. | ✓ Clean |
Nc1nc(O)c2c(n1)NC[C@H]1CCN(c3ccc(C(=O)N[C@@H](C…
|
| ZINC8628706 ZINC | 0.582 | 470.5 Da LogP 0.19 TPSA 194.0 | 1 viol. | ✓ Clean |
Nc1nc(O)c2c(n1)NC[C@H]1CCN(c3ccc(C(=O)N[C@H](CC…
|
| ZINC8628707 ZINC | 0.582 | 470.5 Da LogP 0.19 TPSA 194.0 | 1 viol. | ✓ Clean |
Nc1nc(O)c2c(n1)NC[C@@H]1CCN(c3ccc(C(=O)N[C@@H](…
|
| ZINC8628708 ZINC | 0.582 | 470.5 Da LogP 0.19 TPSA 194.0 | 1 viol. | ✓ Clean |
Nc1nc(O)c2c(n1)NC[C@@H]1CCN(c3ccc(C(=O)N[C@H](C…
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.