KpKP13 Protein target profile

Enoyl-[acyl-carrier-protein] reductase [NADH]

Accession: KP13_05433

Gene: AHE44976.1 fabI 3D evidence: Experimental + ColabFold model UniProt A0A1Y0Q1M7
Length 262
Pocket druggability (P2Rank · Experimental) 0.05
Direct ligand evidence 0 127 total records
Functional annotation 1 EC 3 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
Hit
Human identity (%)
30.928 Lower values reduce human off-target concern.
Human E-value
2.07e-07
Gut microbiome similarity
5.1% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
93.13 Higher values support similarity to known essential genes.
DEG E-value
0.0 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
96.03 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

PDB experimental structure

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.05
Structure 8JTP
Pocket Pocket 1
Druggability (FPocket) 0.532
Structure 8JTP
Pocket Pocket 1
ColabFold model
P2Rank 0.858 · Pocket 1
FPocket 0.344 · Pocket 1
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 244 / 4744 genomes with a hit
Prevalence 5.1%

Sequence

Primary amino-acid sequence viewer.

MGFLSGKRILITGVASKLSIAYGIAQAMHREGAELAFTYQNEKLKGRVEEFAAALGSDIVLPCDVAEDESITALFTELEKVWPKFDGFVHSIGFAPADQLDGDYVDVVTRDGFKIAHDISAYSFVAMAKACRGMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSNLSAGISGEVVHVDGGFNIAAMNELELK

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 3 GO

Subcellular localization

Localization
CytoplasmicMembrane

Enzyme Commission (EC)

1

Gene Ontology (GO)

3
  • GO:0004318 Catalysis of the reaction: a 2,3-saturated acyl-[ACP] + NAD+ = a (2E)-enoyl-[ACP] + H+ + NADH.
  • GO:0006633 The chemical reactions and pathways resulting in the formation of a fatty acid, any of the aliphatic monocarboxylic acids that can be liberated by hydrolysis from naturally occurring fats and oils. Fatty acids are predominantly straight-chain acids of 4 to 24 carbon atoms, which may be saturated or unsaturated; branched fatty acids and hydroxy fatty acids also occur, and very long chain acids of over 30 carbons are found in waxes.
  • GO:0009102 The chemical reactions and pathways resulting in the formation of biotin, cis-tetrahydro-2-oxothieno(3,4-d)imidazoline-4-valeric acid.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

17 records
Show feature table
Start End DB Term Name
6 253 SUPERFAMILY SSF51735 NAD(P)-binding Rossmann-fold domains
6 253 InterPro IPR036291 NAD(P)-binding domain superfamily
6 253 CDD cd05372 ENR_SDR
6 253 InterPro IPR014358 Enoyl-[acyl-carrier-protein] reductase (NADH)
1 260 PIRSF PIRSF000094 Enoyl-ACP_rdct
1 260 InterPro IPR014358 Enoyl-[acyl-carrier-protein] reductase (NADH)
1 262 FunFam G3DSA:3.40.50.720:FF:000054 Enoyl-[acyl-carrier-protein] reductase [NADH]
4 257 PANTHER PTHR43159 ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
4 257 InterPro IPR014358 Enoyl-[acyl-carrier-protein] reductase (NADH)
13 252 Pfam PF13561 Enoyl-(Acyl carrier protein) reductase
8 25 PRINTS PR00081 Glucose/ribitol dehydrogenase family signature
8 25 InterPro IPR002347 Short-chain dehydrogenase/reductase SDR
180 197 PRINTS PR00081 Glucose/ribitol dehydrogenase family signature
180 197 InterPro IPR002347 Short-chain dehydrogenase/reductase SDR
215 235 PRINTS PR00081 Glucose/ribitol dehydrogenase family signature
215 235 InterPro IPR002347 Short-chain dehydrogenase/reductase SDR
1 262 Gene3D G3DSA:3.40.50.720 -

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.05
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #1
0.532
Show in viewer
Surrounding area
All structural evidence 1 experimental · 1 predicted

Structural evidence

1 + 1

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
PDB 8JTP
X-ray 2.90 Å A,B,C,D
100.0% 1-262
Viewing
ColabFold KP13_05433
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

127 records
Chemistry signal

Structural and bioactivity evidence are both available for this target.

Direct evidence 0 same-protein records
Transferred evidence 77 records from similar proteins
Structural ligands 17 0 loaded crystals
Measured bioactivity 60 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
0WE PDB via homolog 377.4 Da · LogP 3.61 · TPSA 75.4 Open detail RCSB PDB
1S5 PDB via homolog Detail RCSB PDB
654 PDB via homolog Detail RCSB PDB
68O PDB via homolog Detail RCSB PDB
69H PDB via homolog Detail RCSB PDB

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
0WE RCSB PDB P0AEK4 377.4 Da LogP 3.61 TPSA 75.4 ✓ Ro5 ✓ Clean Cc1c2ccccc2oc1CN(C)C(=O)CCc3cc4c(nc3)NC(=O)CC4
1S5 RCSB PDB A0A0H3HP34 314.4 Da LogP 4.19 TPSA 57.2 ✓ Ro5 ✓ Clean CCCCCCC1=CC(=O)C(=CN1C)Oc2ccc(cc2C)N
654 RCSB PDB P0AEK4 254.4 Da LogP 3.97 TPSA 17.8 ✓ Ro5 ✓ Clean Cc1ccc(cc1)Cn2cc(nc2)c3cccs3
68O RCSB PDB A0A0H3HP34 250.2 Da LogP 4.03 TPSA 29.5 ✓ Ro5 ✓ Clean CCc1cc(c(cc1F)Oc2ccccc2F)O
69H RCSB PDB A0A0H3HP34 302.4 Da LogP 5.75 TPSA 29.5 1 viol. ✓ Clean CCCCCCc1cc(c(cc1F)Oc2ccccc2C)O
69J RCSB PDB A0A0H3HP34 277.3 Da LogP 3.79 TPSA 72.6 ✓ Ro5 ✓ Clean CCc1cc(c(cc1F)Oc2ccccc2[N+](=O)[O-])O
69K RCSB PDB A0A0H3HP34 247.3 Da LogP 3.59 TPSA 42.4 ✓ Ro5 ✓ Clean CCc1cc(c(cc1F)Oc2cccnc2C)O
826 RCSB PDB P0AEK4 398.5 Da LogP 4.30 TPSA 65.7 ✓ Ro5 Alert c1ccc2c(c1)c3c(n2Cc4ccc(cc4)O)CN(CC3)C(=O)c5ccc…
9W7 RCSB PDB A0A0H3HP34 311.7 Da LogP 4.45 TPSA 72.6 ✓ Ro5 ✓ Clean CCc1cc(c(cc1F)Oc2ccc(cc2Cl)[N+](=O)[O-])O
AE6 RCSB PDB P0AEK4 385.4 Da LogP 3.62 TPSA 79.2 ✓ Ro5 ✓ Clean Cc1c2ccccc2oc1C3CN(C3)C(=O)/C=C/c4cc5c(nc4)NC(=…
AYM RCSB PDB P0AEK4 320.4 Da LogP 2.83 TPSA 64.2 ✓ Ro5 ✓ Clean Cn1c2ccccc2cc1CN(C)C(=O)\C=C\c3ccc(nc3)N
E9P RCSB PDB A0A0H3HP34 214.3 Da LogP 3.75 TPSA 29.5 ✓ Ro5 ✓ Clean CCc1ccc(c(c1)O)Oc2ccccc2
IDN RCSB PDB P0AEK4 374.4 Da LogP 3.13 TPSA 67.2 ✓ Ro5 ✓ Clean Cn1cc(c2c1cccc2)CN(C)C(=O)\C=C\c3cc4c(nc3)NC(=O…
JA1 RCSB PDB A0A0H3HP34 315.4 Da LogP 5.22 TPSA 72.6 1 viol. ✓ Clean CCCCCCc1ccc(c(c1)O)Oc2ccc(cc2)[N+](=O)[O-]
PV4 RCSB PDB A0A0H3HP34 228.3 Da LogP 4.14 TPSA 29.5 ✓ Ro5 ✓ Clean CCCc1ccc(c(c1)O)Oc2ccccc2
TCL RCSB PDB P0AEK4 289.5 Da LogP 5.14 TPSA 29.5 1 viol. ✓ Clean c1cc(c(cc1Cl)O)Oc2ccc(cc2Cl)Cl
ZAM RCSB PDB P0AEK4 378.5 Da LogP 3.01 TPSA 71.6 ✓ Ro5 ✓ Clean CC(=O)N(C)Cc1cc(ccc1N)C(=O)N(C)Cc2cc3ccccc3n2C

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Structure