Promising target candidate with multiple supporting evidence streams.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- No hit
- Gut microbiome similarity
- 3.1% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- Y
- DEG identity (%)
- 53.297 Higher values support similarity to known essential genes.
- DEG E-value
- 1.4399999999999998e-140 Smaller values mean stronger essential-gene similarity.
Structure confidence
- ColabFold pLDDT
- 89.85 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MARHILFGKDTWVALMMHDAFSLRGLAAGCALLFLVAPAVQAAEQLPDAPSIDARAWILMDYASGKVLSEGNADEKLDPASLTKIMTSYVVGQAIKAGKIKLTDMVTVGRDAWATGNPALRGSSVMFLKPGMQVSVEDLNKGVIIQSGNDASIAIADYVAGSQDAFVSLMNGYAKKMGLTNTTFMTVHGLDAPGQFSTARDMALLTKAMIHDVPEEYAVHKEKEFTFNKIRQPNRNRLLWSSNLNADGVKTGTTAGAGYNLVSSATQGDMRLIAVVLGTKTDRIRFNESEKLLTWGFRFFETVTPIKPDATFVTQRVWFGDSNEAKLGAGEAGSITLPKGQLKNLKASYTLNQPQLTAPLEKGQVVGTIDFKLNDKTIEQRPLIVMESVKEGGFFSRMIDFVLMKLHGWFGSWFS
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- CytoplasmicMembrane
Enzyme Commission (EC)
1Gene Ontology (GO)
10- GO:0006508 The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
- GO:0009002 Catalysis of the reaction: (Ac)2-L-Lys-D-alanyl-D-alanine + H2O = (Ac)2-L-Lys-D-alanine + D-alanine.
- GO:0004180 Catalysis of the hydrolysis of a single C-terminal amino acid residue from a polypeptide chain.
- GO:0030288 The region between the inner (cytoplasmic or plasma) membrane and outer membrane of organisms with two membranes such as Gram negative bacteria. These periplasmic spaces are relatively thick and contain a thin peptidoglycan layer (PGL), also referred to as a thin cell wall.
- GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
- GO:0008658 Binding to penicillin, an antibiotic that contains the condensed beta-lactamthiazolidine ring system.
- GO:0042803 Binding to an identical protein to form a homodimer.
- GO:0071555 A process that results in the assembly, arrangement of constituent parts, or disassembly of the cell wall, the rigid or semi-rigid envelope lying outside the cell membrane of plant, fungal and most prokaryotic cells, maintaining their shape and protecting them from osmotic lysis.
- GO:0009252 The chemical reactions and pathways resulting in the formation of peptidoglycans, any of a class of glycoconjugates found in bacterial cell walls and consisting of long glycan strands of alternating residues of beta-(1,4) linked N-acetylglucosamine and N-acetylmuramic acid, cross-linked by short peptides.
- GO:0008360 Any process that modulates the surface configuration of a cell.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 139 | 156 | PRINTS | PR00725 | D-Ala-D-Ala carboxypeptidase 1 (S11) family signature |
| 139 | 156 | InterPro | IPR018044 | Peptidase S11, D-alanyl-D-alanine carboxypeptidase A |
| 80 | 91 | PRINTS | PR00725 | D-Ala-D-Ala carboxypeptidase 1 (S11) family signature |
| 80 | 91 | InterPro | IPR018044 | Peptidase S11, D-alanyl-D-alanine carboxypeptidase A |
| 166 | 179 | PRINTS | PR00725 | D-Ala-D-Ala carboxypeptidase 1 (S11) family signature |
| 166 | 179 | InterPro | IPR018044 | Peptidase S11, D-alanyl-D-alanine carboxypeptidase A |
| 1 | 42 | Phobius | SIGNAL_PEPTIDE | Signal peptide region |
| 43 | 299 | Gene3D | G3DSA:3.40.710.10 | - |
| 43 | 299 | InterPro | IPR012338 | Beta-lactamase/transpeptidase-like |
| 37 | 299 | FunFam | G3DSA:3.40.710.10:FF:000001 | D-alanyl-D-alanine serine-type carboxypeptidase |
| 1 | 42 | SignalP_GRAM_POSITIVE | SignalP-TM | SignalP-TM |
| 300 | 391 | FunFam | G3DSA:2.60.410.10:FF:000001 | D-alanyl-D-alanine carboxypeptidase dacA |
| 27 | 300 | SUPERFAMILY | SSF56601 | beta-lactamase/transpeptidase-like |
| 27 | 300 | InterPro | IPR012338 | Beta-lactamase/transpeptidase-like |
| 26 | 37 | Phobius | SIGNAL_PEPTIDE_H_REGION | Hydrophobic region of a signal peptide. |
| 300 | 391 | Gene3D | G3DSA:2.60.410.10 | - |
| 300 | 391 | InterPro | IPR037167 | D-Ala-D-Ala carboxypeptidase, C-terminal domain superfamily |
| 43 | 415 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 1 | 25 | Phobius | SIGNAL_PEPTIDE_N_REGION | N-terminal region of a signal peptide. |
| 38 | 42 | Phobius | SIGNAL_PEPTIDE_C_REGION | C-terminal region of a signal peptide. |
| 20 | 42 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 47 | 281 | Pfam | PF00768 | D-alanyl-D-alanine carboxypeptidase |
| 47 | 281 | InterPro | IPR001967 | Peptidase S11, D-alanyl-D-alanine carboxypeptidase A, N-terminal |
| 300 | 391 | SMART | SM00936 | PBP5_C_2 |
| 300 | 391 | InterPro | IPR012907 | Peptidase S11, D-Ala-D-Ala carboxypeptidase A, C-terminal |
| 300 | 393 | SUPERFAMILY | SSF69189 | Penicillin-binding protein associated domain |
| 300 | 393 | InterPro | IPR015956 | Penicillin-binding protein, C-terminal domain superfamily |
| 51 | 304 | PANTHER | PTHR21581 | D-ALANYL-D-ALANINE CARBOXYPEPTIDASE |
| 300 | 391 | Pfam | PF07943 | Penicillin-binding protein 5, C-terminal domain |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Residue sets
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GUM1
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
KP13_04272
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural and bioactivity evidence are both available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| AI8 RCSB PDB | A0A0H2WY27 | 607.7 Da LogP 1.24 TPSA 185.7 | 2 viol. | ✓ Clean |
CCON=C(c1nc(sn1)N)C(=O)N[C@H](C=O)[C@@H]2NC(=C(…
|
|
| AIC RCSB PDB | P08506 | 349.4 Da LogP 0.32 TPSA 112.7 | ✓ Ro5 | ✓ Clean |
CC1([C@@H](N2[C@H](S1)[C@@H](C2=O)NC(=O)[C@@H](…
|
|
| BO9 RCSB PDB | P0AEB2 | 580.4 Da LogP 0.84 TPSA 212.6 | 2 viol. | ✓ Clean |
B([C@@H](C)NC(=O)[C@H](CCCCNC(=O)OCc1ccccc1)NC(…
|
|
| CEW RCSB PDB | A0A0H2WY27 | 401.5 Da LogP -0.89 TPSA 155.1 | ✓ Ro5 | ✓ Clean |
CC1=C(N[C@H](SC1)[C@@H](C=O)NC(=O)C(=NOC)C2=CSC…
|
|
| CXV RCSB PDB | P0AEB2 | 437.9 Da LogP 2.50 TPSA 121.5 | ✓ Ro5 | ✓ Clean |
Cc1c(c(no1)c2ccccc2Cl)C(=O)N[C@@H](C=O)[C@@H]3N…
|
|
| HJ2 RCSB PDB | P0AEB2 | 389.4 Da LogP -0.45 TPSA 179.0 | 1 viol. | ✓ Clean |
CC1=C(N[C@H](SC1)[C@@H](C(=O)O)NC(=O)CCCC[C@@H]…
|
|
| HJ3 RCSB PDB | P0AEB2 | 375.4 Da LogP -0.46 TPSA 158.8 | ✓ Ro5 | ✓ Clean |
CC1([C@@H](N[C@H](S1)[C@@H](C=O)NC(=O)CCCC[C@@H…
|
|
| IM2 RCSB PDB | P0AEB2 | 301.4 Da LogP -0.23 TPSA 122.5 | ✓ Ro5 | ✓ Clean |
[H]/N=C/NCCSC1=C(N[C@H](C1)[C@H](C=O)[C@@H](C)O…
|
|
| MXR RCSB PDB | P0AEB2 | 385.5 Da LogP -0.35 TPSA 119.3 | ✓ Ro5 | ✓ Clean |
C[C@H]1[C@@H](C(=N[C@H]1[C@H](C=O)[C@@H](C)O)C(…
|
|
| NFF RCSB PDB | A0A0H2WY27 | 416.5 Da LogP 2.43 TPSA 104.7 | ✓ Ro5 | ✓ Clean |
CCOc1ccc2ccccc2c1C(=O)N[C@H](C=O)[C@@H]3N[C@H](…
|
|
| OK3 RCSB PDB | P0AEB2 | 357.2 Da LogP 0.04 TPSA 142.1 | ✓ Ro5 | ✓ Clean |
[B-]1([C@H](Cc2cccc(c2O1)C(=O)O)NC(=O)c3ccc(cc3…
|
|
| RB6 RCSB PDB | A0A0H2WY27 | 536.6 Da LogP -1.50 TPSA 212.2 | 3 viol. | ✓ Clean |
C1CNC[C@@H]1N2CC=C(C2=O)CC3=C(N[C@H](SC3)[C@@H]…
|
|
| SIN RCSB PDB | A0A0H2ZFH3 | 118.1 Da LogP -0.06 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
C(CC(=O)O)C(=O)O
|
|
| ZZ7 RCSB PDB | A0A0H2WY27 | 367.4 Da LogP 0.15 TPSA 141.8 | ✓ Ro5 | ✓ Clean |
CC1([C@@H](N[C@H](S1)[C@@H](C(=O)O)NC(=O)[C@@H]…
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
| Ligand | UniProt (homolog) | pchembl | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| CHEMBL520642 ChEMBL | A0A0H2WY27 | — | 534.6 Da LogP -1.44 TPSA 203.4 | 2 viol. | ✓ Clean |
Nc1nc(/C(=N/O)C(=O)N[C@@H]2C(=O)N3C(C(=O)O)=C(/…
|
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC13704471 ZINC | 1.000 | 349.4 Da LogP 0.32 TPSA 112.7 | ✓ Ro5 | ✓ Clean |
CC1(C)S[C@H]2[C@H](NC(=O)[C@@H](N)c3ccccc3)C(=O…
|
| ZINC1607283 ZINC | 1.000 | 349.4 Da LogP 0.32 TPSA 112.7 | ✓ Ro5 | ✓ Clean |
CC1(C)S[C@H]2[C@H](NC(=O)[C@H](N)c3ccccc3)C(=O)…
|
| ZINC255982699 ZINC | 1.000 | 367.4 Da LogP 0.15 TPSA 141.8 | ✓ Ro5 | ✓ Clean |
CC1(C)S[C@H]([C@H](NC(=O)[C@@H](N)c2ccccc2)C(=O…
|
| ZINC2568903 ZINC | 1.000 | 349.4 Da LogP 0.32 TPSA 112.7 | ✓ Ro5 | ✓ Clean |
CC1(C)S[C@@H]2[C@@H](NC(=O)[C@H](N)c3ccccc3)C(=…
|
| ZINC3649954 ZINC | 1.000 | 349.4 Da LogP 0.32 TPSA 112.7 | ✓ Ro5 | ✓ Clean |
CC1(C)S[C@@H]2[C@@H](NC(=O)[C@@H](N)c3ccccc3)C(…
|
| ZINC3830217 ZINC | 1.000 | 349.4 Da LogP 0.32 TPSA 112.7 | ✓ Ro5 | ✓ Clean |
CC1(C)S[C@H]2[C@H](NC(=O)[C@H](N)c3ccccc3)C(=O)…
|
| ZINC3830218 ZINC | 1.000 | 349.4 Da LogP 0.32 TPSA 112.7 | ✓ Ro5 | ✓ Clean |
CC1(C)S[C@@H]2[C@H](NC(=O)[C@H](N)c3ccccc3)C(=O…
|
| ZINC3830219 ZINC | 1.000 | 349.4 Da LogP 0.32 TPSA 112.7 | ✓ Ro5 | ✓ Clean |
CC1(C)S[C@@H]2[C@H](NC(=O)[C@H](N)c3ccccc3)C(=O…
|
| ZINC4062610 ZINC | 1.000 | 349.4 Da LogP 0.32 TPSA 112.7 | ✓ Ro5 | ✓ Clean |
CC1(C)S[C@@H]2[C@H](NC(=O)[C@@H](N)c3ccccc3)C(=…
|
| ZINC4523361 ZINC | 1.000 | 349.4 Da LogP 0.32 TPSA 112.7 | ✓ Ro5 | ✓ Clean |
CC1(C)S[C@H]2[C@@H](NC(=O)[C@@H](N)c3ccccc3)C(=…
|
| ZINC5497159 ZINC | 1.000 | 349.4 Da LogP 0.32 TPSA 112.7 | ✓ Ro5 | ✓ Clean |
CC1(C)S[C@@H]2[C@H](NC(=O)[C@@H](N)c3ccccc3)C(=…
|
| ZINC1821981 ZINC | 0.840 | 365.4 Da LogP 0.02 TPSA 133.0 | ✓ Ro5 | ✓ Clean |
CC1(C)S[C@@H]2[C@@H](NC(=O)[C@@H](N)c3ccc(O)cc3…
|
| ZINC2140544 ZINC | 0.840 | 365.4 Da LogP 0.02 TPSA 133.0 | ✓ Ro5 | ✓ Clean |
CC1(C)S[C@@H]2[C@@H](NC(=O)[C@H](N)c3ccc(O)cc3)…
|
| ZINC3604143 ZINC | 0.840 | 365.4 Da LogP 0.02 TPSA 133.0 | ✓ Ro5 | ✓ Clean |
CC1(C)S[C@H]2[C@H](NC(=O)[C@H](N)c3ccc(O)cc3)C(…
|
| ZINC3604145 ZINC | 0.840 | 365.4 Da LogP 0.02 TPSA 133.0 | ✓ Ro5 | ✓ Clean |
CC1(C)S[C@H]2[C@H](NC(=O)[C@H](N)c3ccc(O)cc3)C(…
|
| ZINC3604147 ZINC | 0.840 | 365.4 Da LogP 0.02 TPSA 133.0 | ✓ Ro5 | ✓ Clean |
CC1(C)S[C@H]2[C@H](NC(=O)[C@@H](N)c3ccc(O)cc3)C…
|
| ZINC3830215 ZINC | 0.840 | 365.4 Da LogP 0.02 TPSA 133.0 | ✓ Ro5 | ✓ Clean |
CC1(C)S[C@@H]2[C@H](NC(=O)[C@H](N)c3ccc(O)cc3)C…
|
| ZINC3830216 ZINC | 0.840 | 365.4 Da LogP 0.02 TPSA 133.0 | ✓ Ro5 | ✓ Clean |
CC1(C)S[C@@H]2[C@H](NC(=O)[C@H](N)c3ccc(O)cc3)C…
|
| ZINC3978046 ZINC | 0.840 | 365.4 Da LogP 0.02 TPSA 133.0 | ✓ Ro5 | ✓ Clean |
CC1(C)S[C@@H]2[C@H](NC(=O)[C@@H](N)c3ccc(O)cc3)…
|
| ZINC4042226 ZINC | 0.840 | 365.4 Da LogP 0.02 TPSA 133.0 | ✓ Ro5 | ✓ Clean |
CC1(C)S[C@@H]2[C@H](NC(=O)[C@@H](N)c3ccc(O)cc3)…
|
| ZINC4534050 ZINC | 0.840 | 365.4 Da LogP 0.02 TPSA 133.0 | ✓ Ro5 | ✓ Clean |
CC1(C)S[C@H]2[C@@H](NC(=O)[C@@H](N)c3ccc(O)cc3)…
|
| ZINC5496946 ZINC | 0.840 | 365.4 Da LogP 0.02 TPSA 133.0 | ✓ Ro5 | ✓ Clean |
CC1(C)S[C@H]2[C@@H](NC(=O)[C@H](N)c3ccc(O)cc3)C…
|
| ZINC11616718 ZINC | 0.765 | 378.4 Da LogP 0.49 TPSA 124.0 | ✓ Ro5 | ✓ Clean |
CC1(C)S[C@@H]2[C@H](NC(=O)[C@@H](C(=O)O)c3ccccc…
|
| ZINC3871878 ZINC | 0.765 | 378.4 Da LogP 0.49 TPSA 124.0 | ✓ Ro5 | ✓ Clean |
CC1(C)S[C@H]2[C@H](NC(=O)[C@H](C(=O)O)c3ccccc3)…
|
| ZINC3871879 ZINC | 0.765 | 378.4 Da LogP 0.49 TPSA 124.0 | ✓ Ro5 | ✓ Clean |
CC1(C)S[C@H]2[C@H](NC(=O)[C@H](C(=O)O)c3ccccc3)…
|
| ZINC3871880 ZINC | 0.765 | 378.4 Da LogP 0.49 TPSA 124.0 | ✓ Ro5 | ✓ Clean |
CC1(C)S[C@@H]2[C@H](NC(=O)[C@H](C(=O)O)c3ccccc3…
|
| ZINC3871881 ZINC | 0.765 | 378.4 Da LogP 0.49 TPSA 124.0 | ✓ Ro5 | ✓ Clean |
CC1(C)S[C@@H]2[C@H](NC(=O)[C@H](C(=O)O)c3ccccc3…
|
| ZINC3978033 ZINC | 0.765 | 378.4 Da LogP 0.49 TPSA 124.0 | ✓ Ro5 | ✓ Clean |
CC1(C)S[C@@H]2[C@H](NC(=O)[C@@H](C(=O)O)c3ccccc…
|
| ZINC4535674 ZINC | 0.765 | 378.4 Da LogP 0.49 TPSA 124.0 | ✓ Ro5 | ✓ Clean |
CC1(C)S[C@H]2[C@@H](NC(=O)[C@H](C(=O)O)c3ccccc3…
|
| ZINC4535676 ZINC | 0.765 | 378.4 Da LogP 0.49 TPSA 124.0 | ✓ Ro5 | ✓ Clean |
CC1(C)S[C@H]2[C@@H](NC(=O)[C@@H](C(=O)O)c3ccccc…
|
| ZINC9212287 ZINC | 0.765 | 378.4 Da LogP 0.49 TPSA 124.0 | ✓ Ro5 | ✓ Clean |
CC1(C)S[C@H]2[C@H](NC(=O)[C@@H](C(=O)O)c3ccccc3…
|
| ZINC3874216 ZINC | 0.755 | 361.4 Da LogP 1.06 TPSA 99.1 | ✓ Ro5 | ✓ Clean |
C=N[C@@H](C(=O)N[C@@H]1C(=O)N2[C@@H](C(=O)O)C(C…
|
| ZINC7997960 ZINC | 0.755 | 361.4 Da LogP 1.06 TPSA 99.1 | ✓ Ro5 | ✓ Clean |
C=N[C@H](C(=O)N[C@@H]1C(=O)N2[C@@H](C(=O)O)C(C)…
|
| ZINC263583677 ZINC | 0.750 | 376.4 Da LogP 0.99 TPSA 103.8 | ✓ Ro5 | ✓ Clean |
CC(=O)[C@H](C(=O)N[C@H]1C(=O)N2[C@H]1SC(C)(C)[C…
|
| ZINC263583678 ZINC | 0.750 | 376.4 Da LogP 0.99 TPSA 103.8 | ✓ Ro5 | ✓ Clean |
CC(=O)[C@H](C(=O)N[C@@H]1C(=O)N2[C@H]1SC(C)(C)[…
|
| ZINC4262137 ZINC | 0.750 | 380.4 Da LogP 3.06 TPSA 114.0 | ✓ Ro5 | ✓ Clean |
CC(C)(C)OC(=O)N[C@@H](CCCCNC(=O)OCc1ccccc1)C(=O…
|
| ZINC4521274 ZINC | 0.750 | 380.4 Da LogP 3.06 TPSA 114.0 | ✓ Ro5 | ✓ Clean |
CC(C)(C)OC(=O)N[C@H](CCCCNC(=O)OCc1ccccc1)C(=O)O
|
| ZINC71404972 ZINC | 0.750 | 376.4 Da LogP 0.99 TPSA 103.8 | ✓ Ro5 | ✓ Clean |
CC(=O)[C@H](C(=O)N[C@H]1C(=O)N2[C@@H](C(=O)O)C(…
|
| ZINC71404973 ZINC | 0.750 | 376.4 Da LogP 0.99 TPSA 103.8 | ✓ Ro5 | ✓ Clean |
CC(=O)[C@@H](C(=O)N[C@H]1C(=O)N2[C@@H](C(=O)O)C…
|
| ZINC71404974 ZINC | 0.750 | 376.4 Da LogP 0.99 TPSA 103.8 | ✓ Ro5 | ✓ Clean |
CC(=O)[C@H](C(=O)N[C@@H]1C(=O)N2[C@@H](C(=O)O)C…
|
| ZINC71404975 ZINC | 0.750 | 376.4 Da LogP 0.99 TPSA 103.8 | ✓ Ro5 | ✓ Clean |
CC(=O)[C@@H](C(=O)N[C@@H]1C(=O)N2[C@@H](C(=O)O)…
|
| ZINC256069287 ZINC | 0.722 | 414.5 Da LogP 0.25 TPSA 141.1 | ✓ Ro5 | ✓ Clean |
CC1(C)S[C@@H]2[C@H](NC(=O)[C@H](c3ccccc3)S(=O)(…
|
| ZINC3875033 ZINC | 0.722 | 414.5 Da LogP 0.25 TPSA 141.1 | ✓ Ro5 | ✓ Clean |
CC1(C)S[C@@H]2[C@H](NC(=O)[C@@H](c3ccccc3)S(=O)…
|
| ZINC3875034 ZINC | 0.722 | 414.5 Da LogP 0.25 TPSA 141.1 | ✓ Ro5 | ✓ Clean |
CC1(C)S[C@@H]2[C@H](NC(=O)[C@@H](c3ccccc3)S(=O)…
|
| ZINC4099012 ZINC | 0.722 | 414.5 Da LogP 0.25 TPSA 141.1 | ✓ Ro5 | ✓ Clean |
CC1(C)S[C@@H]2[C@H](NC(=O)[C@H](c3ccccc3)S(=O)(…
|
| ZINC146548960 ZINC | 0.719 | 399.9 Da LogP 0.68 TPSA 133.0 | ✓ Ro5 | ✓ Clean |
CC1(C)S[C@@H]2[C@H](NC(=O)[C@H](N)c3ccc(O)c(Cl)…
|
| ZINC146549165 ZINC | 0.719 | 399.9 Da LogP 0.68 TPSA 133.0 | ✓ Ro5 | ✓ Clean |
CC1(C)S[C@@H]2[C@H](NC(=O)[C@H](N)c3ccc(O)c(Cl)…
|
| ZINC198842276 ZINC | 0.719 | 399.9 Da LogP 0.68 TPSA 133.0 | ✓ Ro5 | ✓ Clean |
CC1(C)S[C@@H]2[C@H](NC(=O)[C@@H](N)c3ccc(O)c(Cl…
|
| ZINC2382315751 ZINC | 0.719 | 399.9 Da LogP 0.68 TPSA 133.0 | ✓ Ro5 | ✓ Clean |
CC1(C)S[C@@H]2[C@H](NC(=O)[C@@H](N)c3ccc(O)c(Cl…
|
| ZINC54053589 ZINC | 0.714 | 375.4 Da LogP 1.67 TPSA 135.5 | ✓ Ro5 | Alert |
CC1(C)S[C@@H]2[C@H](NC(=O)[C@H](N=[N+]=[N-])c3c…
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.