KpKP13 Protein target profile

Inorganic pyrophosphatase

Accession: KP13_01250

Gene: AHE46687.1 ppa 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GLK2
Length 176
Pocket druggability (P2Rank · AlphaFold DB model) 0.876
Direct ligand evidence 0 58 total records
Functional annotation 1 EC 4 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
5.0% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
97.159 Higher values support similarity to known essential genes.
DEG E-value
1.43e-127 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
97.07 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.876
Structure A0A0H3GLK2
Pocket Pocket 1
Druggability (FPocket) 0.328
Structure A0A0H3GLK2
Pocket Pocket 2
ColabFold model
P2Rank 0.887 · Pocket 1
FPocket 0.534 · Pocket 2
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 235 / 4744 genomes with a hit
Prevalence 5.0%

Sequence

Primary amino-acid sequence viewer.

MSLLNVPAGKDLPEDIYVVIEIPANADPIKYEVDKESGALFVDRFMSTAMFYPCNYGYINHTLSLDGDPVDVLVPTPYPLQPGSVIRCRPVGVLKMTDESGEDAKLVAVPHTKLSKEYDHINDVNDLPELLKAQITHFFEHYKDLEKGKWVKVDGWDNAEAAKAEIVASFERAKQK

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 4 GO

Subcellular localization

Localization
Cytoplasmic

Enzyme Commission (EC)

1

Gene Ontology (GO)

4
  • GO:0005737 The contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
  • GO:0006796 The chemical reactions and pathways involving the phosphate group, the anion or salt of any phosphoric acid.
  • GO:0000287 Binding to a magnesium (Mg) ion.
  • GO:0004427 Catalysis of the reaction: diphosphate + H2O = H+ + 2 phosphate.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

14 records
Show feature table
Start End DB Term Name
66 72 ProSitePatterns PS00387 Inorganic pyrophosphatase signature.
1 176 FunFam G3DSA:3.90.80.10:FF:000001 Inorganic pyrophosphatase
1 176 Gene3D G3DSA:3.90.80.10 Inorganic pyrophosphatase
1 176 InterPro IPR036649 Inorganic pyrophosphatase superfamily
7 171 PANTHER PTHR10286 INORGANIC PYROPHOSPHATASE
7 171 InterPro IPR008162 Inorganic pyrophosphatase
18 173 Pfam PF00719 Inorganic pyrophosphatase
18 173 InterPro IPR008162 Inorganic pyrophosphatase
4 174 SUPERFAMILY SSF50324 Inorganic pyrophosphatase
4 174 InterPro IPR036649 Inorganic pyrophosphatase superfamily
14 171 CDD cd00412 pyrophosphatase
14 171 InterPro IPR008162 Inorganic pyrophosphatase
14 174 Hamap MF_00209 Inorganic pyrophosphatase [ppa].
14 174 InterPro IPR008162 Inorganic pyrophosphatase

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.876
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.004
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.004
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #2
0.328
Show in viewer
Surrounding area
Residue sets
UniProt: Binding site:103-103
UniProt: Binding site:142-142
UniProt: Binding site:30-30
UniProt: Binding site:44-44
UniProt: Binding site:56-56
UniProt: Binding site:66-66
UniProt: Binding site:71-71
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GLK2
AlphaFold DB full sequence Viewing
ColabFold KP13_01250
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

58 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 8 records from similar proteins
Structural ligands 8 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
11X PDB via homolog 184.2 Da · LogP 2.69 · TPSA 24.9 Open detail RCSB PDB
12P PDB via homolog Detail RCSB PDB
6RT PDB via homolog Detail RCSB PDB
6RU PDB via homolog Detail RCSB PDB
928 PDB via homolog Detail RCSB PDB

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
11X RCSB PDB Q3JUV5 184.2 Da LogP 2.69 TPSA 24.9 ✓ Ro5 ✓ Clean c1ccc(cc1)NCc2cccnc2
12P RCSB PDB Q9HWZ6 546.7 Da LogP -0.85 TPSA 142.0 2 viol. ✓ Clean C(COCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCO)O
6RT RCSB PDB P9WI55 304.4 Da LogP 1.97 TPSA 49.6 ✓ Ro5 ✓ Clean c1ccc(cc1)n2cccc2c3nc(nc(n3)N4CC4)N5CC5
6RU RCSB PDB P9WI55 308.4 Da LogP 2.46 TPSA 50.1 ✓ Ro5 ✓ Clean CN(C)c1nc(nc(n1)N(C)C)c2cccn2c3ccccc3
928 RCSB PDB Q3JUV5 218.6 Da LogP 1.98 TPSA 67.6 ✓ Ro5 ✓ Clean c1cc(ccc1n2c(c(cn2)C#N)N)Cl
DPO RCSB PDB A0A0A7XPH7 173.9 Da LogP -3.34 TPSA 135.6 ✓ Ro5 ✓ Clean [O-]P(=O)([O-])OP(=O)([O-])[O-]
LMR RCSB PDB A0A0H3M4F9 134.1 Da LogP -1.09 TPSA 94.8 ✓ Ro5 ✓ Clean C([C@@H](C(=O)O)O)C(=O)O
POP RCSB PDB P0A7A9 176.0 Da LogP -2.08 TPSA 129.9 ✓ Ro5 ✓ Clean O[P@@](=O)([O-])O[P@@](=O)(O)[O-]

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.