KpKP13 Protein target profile

oligoribonuclease

Accession: KP13_32184

Gene: AHE46745.1 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GQI6
Length 199
Pocket druggability (P2Rank · AlphaFold DB model) 0.712
Direct ligand evidence 0 53 total records
Functional annotation 1 EC 4 GO
Target summary

Target candidate with partial support; inspect missing evidence before prioritizing.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
Hit
Human identity (%)
58.696 Lower values reduce human off-target concern.
Human E-value
3.85e-12
Gut microbiome similarity
5.6% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
91.457 Higher values support similarity to known essential genes.
DEG E-value
1.89e-138 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
92.89 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.712
Structure A0A0H3GQI6
Pocket Pocket 1
Druggability (FPocket) 0.317
Structure A0A0H3GQI6
Pocket Pocket 8
ColabFold model
P2Rank 0.406 · Pocket 1
FPocket 0.336 · Pocket 1
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 267 / 4744 genomes with a hit
Prevalence 5.6%

Sequence

Primary amino-acid sequence viewer.

MIHAILDEYSHARRVENSMSANENNLIWIDLEMTGLDPERDRIIEIATLVTDANLNILAEGPTIAVHQSDAQLALMDEWNVRTHTGSGLVDRVKASTVSEHDAELATIEFLKQWVPAGKSPICGNSIGQDRRFLFKYMPQLEAYFHYRYLDVSTLKELARRWKPEILDGFKKQGTHQAMDDIRESVAELAYYREHFIKL

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 4 GO

Subcellular localization

Localization
Cytoplasmic

Enzyme Commission (EC)

1

Gene Ontology (GO)

4
  • GO:0003676 Binding to a nucleic acid.
  • GO:0000175 Catalysis of the sequential cleavage of mononucleotides from a free 3' terminus of an RNA molecule.
  • GO:0005737 The contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
  • GO:0006259 Any cellular metabolic process involving deoxyribonucleic acid. This is one of the two main types of nucleic acid, consisting of a long, unbranched macromolecule formed from one, or more commonly, two, strands of linked deoxyribonucleotides.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

15 records
Show feature table
Start End DB Term Name
26 197 CDD cd06135 Orn
26 197 InterPro IPR022894 Oligoribonuclease
25 198 SMART SM00479 exoiiiendus
25 198 InterPro IPR013520 Exonuclease, RNase T/DNA polymerase III
21 199 Hamap MF_00045 Oligoribonuclease [orn].
21 199 InterPro IPR022894 Oligoribonuclease
71 192 PANTHER PTHR11046 OLIGORIBONUCLEASE, MITOCHONDRIAL
71 192 InterPro IPR022894 Oligoribonuclease
27 188 Pfam PF00929 Exonuclease
27 188 InterPro IPR013520 Exonuclease, RNase T/DNA polymerase III
21 198 SUPERFAMILY SSF53098 Ribonuclease H-like
21 198 InterPro IPR012337 Ribonuclease H-like superfamily
18 199 FunFam G3DSA:3.30.420.10:FF:000003 Oligoribonuclease
11 198 Gene3D G3DSA:3.30.420.10 -
11 198 InterPro IPR036397 Ribonuclease H superfamily

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.712
Likely same site as FPocket 8 6.9 Å 3 shared residues 75% of smaller site
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #8
0.317
Likely same site as P2Rank 1 6.9 Å 3 shared residues 75% of smaller site
Show in viewer
Surrounding area
Pocket 2 FPocket #5
0.232
Show in viewer
Surrounding area
Residue sets
UniProt: Active site:129-129
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GQI6
AlphaFold DB full sequence Viewing
ColabFold KP13_32184
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

53 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 3 records from similar proteins
Structural ligands 3 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
9RC PDB via homolog 443.3 Da · LogP 0.60 · TPSA 183.2 Open detail RCSB PDB
FLC PDB via homolog Detail RCSB PDB
MLI PDB via homolog Detail RCSB PDB
ZINC13520531 ZINC proposed compound · Tanimoto 1.000 Detail ZINC
ZINC13520567 ZINC proposed compound · Tanimoto 0.746 Detail ZINC

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
9RC RCSB PDB Q47VZ4 443.3 Da LogP 0.60 TPSA 183.2 ✓ Ro5 ✓ Clean CC1=CN(C(=O)NC1=O)[C@H]2C[C@@H]([C@H](O2)COP(=O…
FLC RCSB PDB P0A784 189.1 Da LogP -5.25 TPSA 140.6 ✓ Ro5 ✓ Clean C(C(=O)[O-])C(CC(=O)[O-])(C(=O)[O-])O
MLI RCSB PDB Q9Y3B8 102.0 Da LogP -3.12 TPSA 80.3 ✓ Ro5 ✓ Clean C(C(=O)[O-])C(=O)[O-]

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.