KpKP13 Protein target profile

Thiamine-phosphate synthase

Accession: KP13_31609

Gene: thiE AHE46928.1 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GGQ3
Length 211
Pocket druggability (P2Rank · AlphaFold DB model) 0.943
Direct ligand evidence 0 60 total records
Functional annotation 1 EC 5 GO
Target summary

Strong target candidate with converging metabolic, structural and chemical evidence.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
3.1% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
57.368 Higher values support similarity to known essential genes.
DEG E-value
6.68e-62 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
95.22 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.943
Structure A0A0H3GGQ3
Pocket Pocket 1
Druggability (FPocket) 0.713
Structure A0A0H3GGQ3
Pocket Pocket 1
ColabFold model
P2Rank 0.94 · Pocket 1
FPocket 0.547 · Pocket 3
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 145 / 4744 genomes with a hit
Prevalence 3.1%

Sequence

Primary amino-acid sequence viewer.

MYQPDFPPVPFRLGLYPVVDSVAWIERLLEAGVRTLQLRIKDRRDSEVEDDVIAAIALGRRYHARLFINDYWQLAIKHQAYGVHLGQEDLETTDLSAIRQAGLRLGVSTHDDMEIDVALAARPSYIALGHVFPTQTKQMPSAPQGLEQLARHIQRLADYPTVAIGGISLEKAPGVLATGVGSIAVVSAITQAADWRAATNQLLTLAGAGDE

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 5 GO

Subcellular localization

Localization
Cytoplasmic

Enzyme Commission (EC)

1

Gene Ontology (GO)

5
  • GO:0009228 The chemical reactions and pathways resulting in the formation of thiamine (vitamin B1), a water soluble vitamin present in fresh vegetables and meats, especially liver.
  • GO:0004789 Catalysis of the reaction: 4-amino-2-methyl-5-diphosphomethylpyrimidine + 4-methyl-5-(2-phosphoethyl)-thiazole + H+ = diphosphate + thiamine phosphate.
  • GO:0005737 The contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
  • GO:0000287 Binding to a magnesium (Mg) ion.
  • GO:0009229 The chemical reactions and pathways resulting in the formation of thiamine diphosphate, a derivative of thiamine (vitamin B1) which acts as a coenzyme in a range of processes including the Krebs cycle.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

14 records
Show feature table
Start End DB Term Name
8 206 FunFam G3DSA:3.20.20.70:FF:000064 Thiamine-phosphate synthase
20 202 NCBIfam TIGR00693 thiamine phosphate synthase
20 202 InterPro IPR034291 Thiamine phosphate synthase
15 203 CDD cd00564 TMP_TenI
15 203 InterPro IPR022998 Thiamine phosphate synthase/TenI
10 207 Hamap MF_00097 Thiamine-phosphate synthase [thiE].
10 207 InterPro IPR034291 Thiamine phosphate synthase
9 205 Gene3D G3DSA:3.20.20.70 Aldolase class I
9 205 InterPro IPR013785 Aldolase-type TIM barrel
6 204 SUPERFAMILY SSF51391 Thiamin phosphate synthase
6 204 InterPro IPR036206 Thiamin phosphate synthase superfamily
13 205 PANTHER PTHR20857 THIAMINE-PHOSPHATE PYROPHOSPHORYLASE
21 189 Pfam PF02581 Thiamine monophosphate synthase
21 189 InterPro IPR022998 Thiamine phosphate synthase/TenI

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.943
Likely same site as FPocket 1 1.5 Å 26 shared residues 90% of smaller site
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #1
0.713
Likely same site as P2Rank 1 1.5 Å 26 shared residues 90% of smaller site
Show in viewer
Surrounding area
Residue sets
UniProt: Binding site:108-108
UniProt: Binding site:134-136
UniProt: Binding site:137-137
UniProt: Binding site:166-166
UniProt: Binding site:186-187
UniProt: Binding site:37-41
UniProt: Binding site:69-69
UniProt: Binding site:70-70
UniProt: Binding site:89-89
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GGQ3
AlphaFold DB full sequence Viewing
ColabFold KP13_31609
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

60 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 10 records from similar proteins
Structural ligands 10 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
3NM PDB via homolog 267.2 Da · LogP 0.80 · TPSA 117.0 Open detail RCSB PDB
ACP PDB via homolog Detail RCSB PDB
FQP PDB via homolog Detail RCSB PDB
FTP PDB via homolog Detail RCSB PDB
ICP PDB via homolog Detail RCSB PDB

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
3NM RCSB PDB P39594 267.2 Da LogP 0.80 TPSA 117.0 ✓ Ro5 ✓ Clean Cc1c(sc(n1)C(=O)O)CCOP(=O)(O)O
ACP RCSB PDB Q6FV03 505.2 Da LogP -1.52 TPSA 269.9 3 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
FQP RCSB PDB P39594 353.1 Da LogP 0.80 TPSA 165.1 ✓ Ro5 ✓ Clean c1c(c(nc(n1)C(F)(F)F)N)CO[P@](=O)(O)OP(=O)(O)O
FTP RCSB PDB P39594 397.3 Da LogP 0.17 TPSA 128.1 ✓ Ro5 ✓ Clean Cc1c(sc[n+]1Cc2cnc(nc2N)C(F)(F)F)CCOP(=O)([O-])…
ICP RCSB PDB P39594 121.1 Da LogP 1.02 TPSA 48.6 ✓ Ro5 ✓ Clean CC1=NC(=N)C(=C)C=N1
IFP RCSB PDB P39594 175.1 Da LogP 1.57 TPSA 48.6 ✓ Ro5 ✓ Clean C=C1C=NC(=NC1=N)C(F)(F)F
POP RCSB PDB P39594 176.0 Da LogP -2.08 TPSA 129.9 ✓ Ro5 ✓ Clean O[P@@](=O)([O-])O[P@@](=O)(O)[O-]
TPS RCSB PDB P39594 345.3 Da LogP 0.72 TPSA 122.4 ✓ Ro5 ✓ Clean Cc1c(sc[n+]1Cc2cnc(nc2N)C)CCOP(=O)(O)O
TZE RCSB PDB Q6FV03 143.2 Da LogP 0.99 TPSA 33.1 ✓ Ro5 ✓ Clean Cc1c(scn1)CCO
TZP RCSB PDB P39594 223.2 Da LogP 1.10 TPSA 79.7 ✓ Ro5 ✓ Clean Cc1c(scn1)CCOP(=O)(O)O

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.