Protein target profile

KP13_31805

Sulfur carrier protein ThiS adenylyltransferase

Genome: KpKP13 Gene: thiF AHE46929.1 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GQ09
Length 251
Pocket druggability 0.159
Direct ligand evidence 0 89 total records
Functional annotation 0 EC 7 GO
Target summary

Target candidate with partial support; inspect missing evidence before prioritizing.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
Hit
Human identity (%)
41.036 Lower values reduce human off-target concern.
Human E-value
5.49e-42
Gut microbiome similarity
2.3% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
48.996 Higher values support similarity to known essential genes.
DEG E-value
9.11e-78 Smaller values mean stronger essential-gene similarity.

Localization

Localization
CytoplasmicMembrane

Structure confidence

ColabFold pLDDT
94.28 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

The selected pocket score is the FPocket value used for ranking after applying the curated structure priority. It estimates small-molecule pocket quality; it is not experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

FPocket 0.159
Structure A0A0H3GQ09
Pocket Pocket 4
P2Rank 0.919
Structure A0A0H3GQ09
Pocket Pocket 1
ColabFold model
FPocket 0.132 · Pocket 5
P2Rank 0.886 · Pocket 1
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 111 / 4744 genomes with a hit
Prevalence 2.3%

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Sequence

Primary amino-acid sequence viewer.

MNDHDFMRYSRQLLLEDIAIEGQQKLLASRVLIIGLGGLGSPAALYLAGAGVGTLTLADDDAVHLSNLQRQILFTSADIDRPKAAAAQTRLSQLNPQIKLVALQQRLSGEALRAEVAKADVVLDCTDNMVTRQAINAACVALDTPLVTASAVGFGGQLMVLTPPWTQGCYRCLWPESDEPQRNCRTAGIVGPVVGMMGTLQALETIKLLSGMATPRNTLRLFDARTSNWRALALQRSRSCPVCGGRHADLV

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

7 GO

Gene Ontology (GO)

7
  • GO:0008641 Catalysis of the activation of small proteins, such as ubiquitin or ubiquitin-like proteins, through the formation of an ATP-dependent high-energy thiolester bond.
  • GO:0005829 The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
  • GO:0005524 Binding to ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
  • GO:0046872 Binding to a metal ion.
  • GO:0016779 Catalysis of the transfer of a nucleotidyl group from one compound (donor) to another (acceptor).
  • GO:0008146 Catalysis of the transfer of a sulfate group from 3'-phosphoadenosine 5'-phosphosulfate to the hydroxyl group of an acceptor, producing the sulfated derivative and 3'-phosphoadenosine 5'-phosphate.
  • GO:0004792 Catalysis of the reaction: thiosulfate + hydrogen cyanide = thiocyanate + sulfite + 2 H+.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

12 records
Show feature table
Start End DB Term Name
3 248 FunFam G3DSA:3.40.50.720:FF:000080 Thiazole biosynthesis adenylyltransferase ThiF
9 241 Pfam PF00899 ThiF family
9 241 InterPro IPR000594 THIF-type NAD/FAD binding fold
8 234 CDD cd00757 ThiF_MoeB_HesA_family
5 224 PANTHER PTHR10953 UBIQUITIN-ACTIVATING ENZYME E1
5 224 InterPro IPR045886 ThiF/MoeB/HesA family
1 250 Gene3D G3DSA:3.40.50.720 -
26 48 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
2 246 SUPERFAMILY SSF69572 Activating enzymes of the ubiquitin-like proteins
2 246 InterPro IPR035985 Ubiquitin-activating enzyme
8 209 NCBIfam TIGR02356 thiazole biosynthesis adenylyltransferase ThiF
8 209 InterPro IPR012731 Thiazole biosynthesis adenylyltransferase ThiF

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Site 1 P2Rank #1
0.919
Show in viewer
Surrounding area
Residue sets
UniProt: Active site:184-184 Glycyl persulfide ester intermediate
UniProt: Binding site:107-107
UniProt: Binding site:11-11
UniProt: Binding site:127-131
UniProt: Binding site:169-169
UniProt: Binding site:172-172
UniProt: Binding site:240-240
UniProt: Binding site:243-243
UniProt: Binding site:38-38
UniProt: Binding site:59-59
UniProt: Binding site:70-70
UniProt: Binding site:83-83
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GQ09
AlphaFold DB full sequence Viewing
ColabFold KP13_31805
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

89 records
Chemistry signal

Structural and bioactivity evidence are both available for this target.

Direct evidence 0 same-protein records
Transferred evidence 39 records from similar proteins
Structural ligands 9 0 loaded crystals
Measured bioactivity 30 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
8E7 PDB via homolog 217.4 Da · LogP 3.65 · TPSA 12.0 Open detail RCSB PDB
8EA PDB via homolog Detail RCSB PDB
APC PDB via homolog Detail RCSB PDB
FHJ PDB via homolog Detail RCSB PDB
JZU PDB via homolog Detail RCSB PDB

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
8E7 RCSB PDB O94609 217.4 Da LogP 3.65 TPSA 12.0 ✓ Ro5 ✓ Clean CCCCCCCCCCNCCS
8EA RCSB PDB O94609 374.1 Da LogP 6.95 TPSA 12.0 1 viol. ✓ Clean CCCCCCCCCCNCCSSCc1ccc(cc1)Cl
APC RCSB PDB Q47506 505.2 Da LogP -1.52 TPSA 269.9 3 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
FHJ RCSB PDB Q9UBT2 421.5 Da LogP 3.30 TPSA 73.9 ✓ Ro5 ✓ Clean Cc1ccc(cc1)C[C@@H]([C@@]23C=C[C@@H](O2)[C@@H]([…
JZU RCSB PDB O94609 345.3 Da LogP -3.18 TPSA 191.5 ✓ Ro5 ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
ND7 RCSB PDB Q47506 346.2 Da LogP -1.90 TPSA 191.9 ✓ Ro5 ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
PG0 RCSB PDB O94609 120.1 Da LogP -0.36 TPSA 38.7 ✓ Ro5 ✓ Clean COCCOCCO
POP RCSB PDB P22314 176.0 Da LogP -2.08 TPSA 129.9 ✓ Ro5 ✓ Clean O[P@@](=O)([O-])O[P@@](=O)(O)[O-]
VMX RCSB PDB O94609 387.4 Da LogP -2.70 TPSA 191.5 1 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.